Align mannose-6-phosphate isomerase (EC 5.3.1.8) (characterized)
to candidate WP_022947775.1 H035_RS18120 mannose-6-phosphate isomerase, class I
Query= ecocyc::MANNPISOM-MONOMER (391 letters) >NCBI__GCF_000421465.1:WP_022947775.1 Length = 416 Score = 236 bits (603), Expect = 7e-67 Identities = 151/375 (40%), Positives = 205/375 (54%), Gaps = 16/375 (4%) Query: 4 LINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRDVIE 63 L VQ YAWG + L G NP P AELW+GAHP ++ VSL D++ Sbjct: 26 LFCGVQQYAWGDFDFIPRLLGKTNPDRDPFAELWIGAHPDLPAQAV-IGRTRVSLSDLLP 84 Query: 64 SDKSTLLGEAVAKRF-GELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMDAA 122 LLG R+ G+LPFL K+L A +PLSIQVHP+KH +E GFA+E+ IP+D+ Sbjct: 85 EAVECLLGADAKIRYQGQLPFLMKILAAGRPLSIQVHPDKHQAEAGFAREHRLKIPLDSP 144 Query: 123 ERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERLSE 182 RNY+D NHKPEL+ ALT F A+ FR SEI L + P ++ E L + Sbjct: 145 RRNYRDCNHKPELLCALTDFYALKGFRPESEIADQLASI----PEWRGLAERFRDEGLKK 200 Query: 183 LFASLLNMQGEEKSRALAILKSAL------DSQQGEPW--QTIRLISEFYPEDSGLFSPL 234 + L+ + LA + + L + E W + L S+ D GLFS Sbjct: 201 FYYHLMTLPQSVVDEMLAPVVARLRWEGPFPKDRREYWLLRADELYSQGAHHDRGLFSLY 260 Query: 235 LLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFE 294 LLN + L PGEA+F A H+YL+GV +EVMANS+NVLR GLTPK++D+P L+ VKFE Sbjct: 261 LLNFLCLRPGEAIFQHAGELHSYLEGVGVEVMANSNNVLRGGLTPKHVDVPALLEIVKFE 320 Query: 295 AKPANQLLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDATLWK 354 K A L ++ + GA +P PVD+F S DLS T S+ + +EG + Sbjct: 321 GKKAEILSSRHQEGGAA--YPAPVDEFVLSCLDLSCGRTYSSEGPLRLGIVLEGSVRVNW 378 Query: 355 GSQQLQLKPGESAFI 369 + Q++L G+S I Sbjct: 379 ETGQMRLFRGQSFLI 393 Lambda K H 0.316 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 416 Length adjustment: 31 Effective length of query: 360 Effective length of database: 385 Effective search space: 138600 Effective search space used: 138600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_022947775.1 H035_RS18120 (mannose-6-phosphate isomerase, class I)
to HMM TIGR00218 (manA: mannose-6-phosphate isomerase, class I (EC 5.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00218.hmm # target sequence database: /tmp/gapView.20327.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00218 [M=359] Accession: TIGR00218 Description: manA: mannose-6-phosphate isomerase, class I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-77 247.1 0.0 1.9e-77 246.8 0.0 1.0 1 lcl|NCBI__GCF_000421465.1:WP_022947775.1 H035_RS18120 mannose-6-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000421465.1:WP_022947775.1 H035_RS18120 mannose-6-phosphate isomerase, class I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 246.8 0.0 1.9e-77 1.9e-77 7 356 .. 26 408 .. 24 411 .. 0.93 Alignments for each domain: == domain 1 score: 246.8 bits; conditional E-value: 1.9e-77 TIGR00218 7 vqknlkerdWGkgtaladllgysipskq.taElWagaHkkgsSkvqng.kkvsLrdliekhksellGka 73 ++ ++++++WG+ ++++ llg ++p + aElW gaH+ + + g vsL+dl+ + + llG + lcl|NCBI__GCF_000421465.1:WP_022947775.1 26 LFCGVQQYAWGDFDFIPRLLGKTNPDRDpFAELWIGAHPDLPAQAVIGrTRVSLSDLLPEAVECLLGAD 94 67789********************9888***************999889******************* PP TIGR00218 74 eadrf..elPlLvkvLsaekplsiqvHPdkalakigyake..........krnYkDknhkpelvialtd 130 ++ r+ +lP+L+k+L a +plsiqvHPdk+ a+ g+a+e +rnY+D nhkpel+ altd lcl|NCBI__GCF_000421465.1:WP_022947775.1 95 AKIRYqgQLPFLMKILAAGRPLSIQVHPDKHQAEAGFAREhrlkipldspRRNYRDCNHKPELLCALTD 163 *999999************************************************************** PP TIGR00218 131 fealkgfkp.......Lkriaelheeaer.....lgkteawviiasdekikeaaeilkealkns..... 182 f+alkgf+p L i+e ++ aer l+k +++ + + e + ++ +l + lcl|NCBI__GCF_000421465.1:WP_022947775.1 164 FYALKGFRPeseiadqLASIPEWRGLAERfrdegLKKFYYHLMTLPQSVVDEMLAPVVARLRWEgpfpk 232 *********999999999999999999998877788888888888888888888888888888899999 PP TIGR00218 183 .keelkekiqrliyp....edvglfkgllLnrvklkpgeaiyvrsgtvHAykggdvlEvmanSdnvvra 246 ++e++ + +y d glf+ lLn + l+pgeai+ ++g++H y++g+ +EvmanS+nv+r lcl|NCBI__GCF_000421465.1:WP_022947775.1 233 dRREYWLLRADELYSqgahHDRGLFSLYLLNFLCLRPGEAIFQHAGELHSYLEGVGVEVMANSNNVLRG 301 999**99887666652222467*********************************************** PP TIGR00218 247 gltdkyldvkklvevltveekpeeklkeqkqkegaevlflvpieefavlktdlsekaelksqdsalill 315 glt+k +dv+ l+e++++e k++e l +++q+ g +++p++ef ++ dls + s+ + + + lcl|NCBI__GCF_000421465.1:WP_022947775.1 302 GLTPKHVDVPALLEIVKFEGKKAEILSSRHQEGG--AAYPAPVDEFVLSCLDLSCGRTYSSEGPLRLGI 368 ******************************9998..89*******************9*********** PP TIGR00218 316 vleGdglilsgekklklkkGesfliaakleevtiegedeal 356 vleG+ ++ + ++ l +G+sfli+ +++ed+ + lcl|NCBI__GCF_000421465.1:WP_022947775.1 369 VLEGSVRVNWETGQMRLFRGQSFLIPHGC-RCRLQSEDDVV 408 **************************988.77777777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (359 nodes) Target sequences: 1 (416 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.67 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory