Align Trehalose transport system permease protein SugB (characterized)
to candidate WP_022947843.1 H035_RS0104690 carbohydrate ABC transporter permease
Query= SwissProt::P9WG01 (274 letters) >NCBI__GCF_000421465.1:WP_022947843.1 Length = 278 Score = 345 bits (886), Expect = e-100 Identities = 167/267 (62%), Positives = 214/267 (80%) Query: 8 YWAVLDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGDLFSSALI 67 +W +V+ YAL+PV WI SLSLKP + + D + IP+++TF++YR IF+ F AL Sbjct: 12 FWIFGSLIVIVYALIPVAWILSLSLKPPADLNDRRFIPNSITFEHYRAIFQDLQFPHALW 71 Query: 68 NSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTPLFNIERA 127 NS+GI ++T++AVVLGAMAAYA+ RL+FPGKR+++ AL I MFP IS++ PLF + RA Sbjct: 72 NSLGIAFLSTLLAVVLGAMAAYAIVRLDFPGKRVVLAGALAIAMFPPISIIGPLFEMWRA 131 Query: 128 IGLFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFRKVIVPLA 187 IGLFDTWPGL+LPY+TF LPL+I+TLSAFFR++PWDLEKAA++DGAT QAF VI P+A Sbjct: 132 IGLFDTWPGLMLPYMTFTLPLSIWTLSAFFRDVPWDLEKAARIDGATRLQAFTHVIAPIA 191 Query: 188 APGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIV 247 APG V A +L+FIFAWND L A+SLT+T A T PVAIA FTGSS+FE PTGSIAA ++V Sbjct: 192 APGAVAAGLLIFIFAWNDFLFAISLTSTNKARTVPVAIAFFTGSSRFELPTGSIAAASVV 251 Query: 248 ITIPIIVFVLIFQRRIVAGLTSGAVKG 274 +T PII+ VLIFQR +V GLT+GA+KG Sbjct: 252 VTAPIILLVLIFQRWLVTGLTAGAIKG 278 Lambda K H 0.327 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 278 Length adjustment: 25 Effective length of query: 249 Effective length of database: 253 Effective search space: 62997 Effective search space used: 62997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory