Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate WP_022948198.1 H035_RS0106590 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q9RW56 (523 letters) >NCBI__GCF_000421465.1:WP_022948198.1 Length = 486 Score = 226 bits (576), Expect = 1e-63 Identities = 151/473 (31%), Positives = 241/473 (50%), Gaps = 20/473 (4%) Query: 44 IDGQEVDTEG--KIQSINPCDTSEVVGTTAKATIGDAENALQGAWKAFESWKKWDMDARA 101 I GQ VD +G ++ +NP D +++GT + A+ A + FE W+K R Sbjct: 18 IGGQWVDADGGATLEVVNPSD-QQILGTVPDMAEAETRGAIAAAREGFEVWRKKTAAERG 76 Query: 102 RILLKAAAILKRRRLEACALMSIEVGKNYAEADVEVAEAIDFLEYYARSAMKYAGFGSSE 161 IL + ++ + + LM++E GK EA E+A A FL+++A + + +G + Sbjct: 77 EILYRWYELMMALQDDLGRLMTLEQGKPLPEAKGEIAYAAGFLKWFAEESRR--AYGDTI 134 Query: 162 TTWFEGEENGLMSIPLGVGVSISPWNFPCAIFVGMAAAPIVAGNCVVVKPAEDAGLIAGF 221 G+ ++ P+GV V+I+PWNFP A+ A A + AG +VVKPA + A Sbjct: 135 PAAKPGQHIVVIKQPVGVSVAITPWNFPSAMITRKAGAALAAGCSMVVKPAAETPFSALA 194 Query: 222 MVDILREAGLPAGVLQFLPGVGKEVGEYLTTHAKTRFITFTGSRAVGLHINEVAAKVQPG 281 + ++ AGLP GVL + G +G+ LT+ A R ++FTGS VG + A Sbjct: 195 LAELGERAGLPNGVLNVITGDAVRIGQTLTSSATVRKLSFTGSTEVGRKLMAQCA----- 249 Query: 282 QKWIKRVIMELGGKDGLIVDETADIENAITAATQGAFGFNGQKCSAMSRLIVVDSVYDEV 341 + I+++ +ELGG +V + AD++ A+ A F GQ C +R +V + V+D Sbjct: 250 -EHIQKISLELGGNAPFLVFDDADLDKAVEGAMASKFRNTGQTCVCANRFLVQEGVHDAF 308 Query: 342 VNGFVERAKALKMGTG-EENANVTAVVNQMSFNKIKGYLELAPSEGKVLLGGEATGEANG 400 V + L++G G EE N +A++NQ + +K+ +L A +G L+ G GEA+ Sbjct: 309 VEKLKTAMETLRVGNGLEEGVNQSALINQAAVDKVDEHLRDAVGKGARLILG---GEAHP 365 Query: 401 KQGYYIQPTIVGDVDRNSRLAQEEIFGPVVAVLRAKDWQDALDIANSTEYGLTGGVCSNS 460 G Y+QP ++ V + +L EE FGPV AV++ + ++A+ +AN T YGL S Sbjct: 366 LGGTYVQPALLTGVTPDMQLCHEETFGPVAAVMKFQTEEEAIRLANDTPYGLASYFYSRD 425 Query: 461 RERLEQARAEFEVGNLYFNRKITGAIVGVQPFGGYNMSG---TDSKAGGPDYL 510 R+ + E G + N + V PFGG SG SK G +YL Sbjct: 426 IHRVWRVAEALEAGIVGINEGLISN--PVAPFGGVKESGIGREGSKYGMEEYL 476 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 608 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 523 Length of database: 486 Length adjustment: 34 Effective length of query: 489 Effective length of database: 452 Effective search space: 221028 Effective search space used: 221028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory