Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_022948198.1 H035_RS0106590 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::C6KEM4 (506 letters) >NCBI__GCF_000421465.1:WP_022948198.1 Length = 486 Score = 318 bits (814), Expect = 4e-91 Identities = 181/482 (37%), Positives = 273/482 (56%), Gaps = 11/482 (2%) Query: 5 QTIPRRGLFIGGAWREPCLGRRLPVVNPATEATIGDIPAGTAEDVEIAVAAARDAFSRDG 64 Q + R+ +IGG W + G L VVNP+ + +G +P + A+AAAR+ F Sbjct: 9 QNLFRQQCYIGGQWVDADGGATLEVVNPSDQQILGTVPDMAEAETRGAIAAAREGFE--- 65 Query: 65 GRQWSRAPGAVRANFLRAIAAKIKDRKSELALLETLDSGKPLDEASGDMDDVAACFEYYA 124 W + A R L + + +L L TL+ GKPL EA G++ A +++A Sbjct: 66 --VWRKKTAAERGEILYRWYELMMALQDDLGRLMTLEQGKPLPEAKGEIAYAAGFLKWFA 123 Query: 125 DLAEALDGKQRSPISLPMENFKSYVLKEPIGVVGLITPWNYPLLMATWKVAPALAAGCTT 184 + + G P + P ++ V+K+P+GV ITPWN+P M T K ALAAGC+ Sbjct: 124 EESRRAYG-DTIPAAKPGQHI--VVIKQPVGVSVAITPWNFPSAMITRKAGAALAAGCSM 180 Query: 185 ILKPSELASVSCLELGAICMEIGLPPGVLNIITGLGPEAGAPLSSHSHVDKVAFTGSTET 244 ++KP+ S L L + GLP GVLN+ITG G L+S + V K++FTGSTE Sbjct: 181 VVKPAAETPFSALALAELGERAGLPNGVLNVITGDAVRIGQTLTSSATVRKLSFTGSTEV 240 Query: 245 GKRIMTSAAQMVKPVSLELGGKSPLIVFDDIGDIDKAVEWTMFGIFANAGQVCSATSRLL 304 G+++M A+ ++ +SLELGG +P +VFDD D+DKAVE M F N GQ C +R L Sbjct: 241 GRKLMAQCAEHIQKISLELGGNAPFLVFDD-ADLDKAVEGAMASKFRNTGQTCVCANRFL 299 Query: 305 LHEKIAKKFLDRLVAWAKNIKVSDPLEEGCRLGSVISEGQYEKIKKFISTARSEGATILY 364 + E + F+++L + ++V + LEEG ++I++ +K+ + + A +GA ++ Sbjct: 300 VQEGVHDAFVEKLKTAMETLRVGNGLEEGVNQSALINQAAVDKVDEHLRDAVGKGARLIL 359 Query: 365 GGGRPQHLRRGFFLEPTIITDVSTSMQIWQEEVFGPVICVKEFRTDSEAVELANDTHYGL 424 GG H G +++P ++T V+ MQ+ EE FGPV V +F+T+ EA+ LANDT YGL Sbjct: 360 GG--EAHPLGGTYVQPALLTGVTPDMQLCHEETFGPVAAVMKFQTEEEAIRLANDTPYGL 417 Query: 425 AGAVISNDQERCERISKALHSGIIWINCSQPCFVQAPWGGNKRSGFGRELGEWGLDNYLT 484 A S D R R+++AL +GI+ IN AP+GG K SG GRE ++G++ YL Sbjct: 418 ASYFYSRDIHRVWRVAEALEAGIVGINEGLISNPVAPFGGVKESGIGREGSKYGMEEYLE 477 Query: 485 VK 486 VK Sbjct: 478 VK 479 Lambda K H 0.318 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 486 Length adjustment: 34 Effective length of query: 472 Effective length of database: 452 Effective search space: 213344 Effective search space used: 213344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory