Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_022948199.1 H035_RS0106595 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000421465.1:WP_022948199.1 Length = 415 Score = 189 bits (481), Expect = 1e-52 Identities = 131/397 (32%), Positives = 200/397 (50%), Gaps = 31/397 (7%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQ--ELLDPLRAMLAKTL 133 L D G +++D G G+ GH +P VV+A Q Q+A +H+Q + P L L Sbjct: 24 LYDAAGTKYLDFTSGIGVTATGHCHPTVVAAAQKQVATL-VHAQYTTVKHPRMLELTDRL 82 Query: 134 AALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKFTFIATSGAFHGKSLGALSATAK 193 P +L F NSG+E+VE+A++LA+ G+ IA G FHG+++GA S T Sbjct: 83 YERLPAELDAIAFWNSGSEAVESAVRLAR---QATGRANIIAFQGGFHGRTMGAASLTTS 139 Query: 194 ST-FRKPFMPLLPGFRHVPFGNI--------EAMRTALNEC------KKTGDDVAAVILE 238 + R F P++ G + PF + E R L E + D AA+I+E Sbjct: 140 TPKVRTGFHPMMAGVVYAPFPHTYRYGWSEEETTRFCLQELDHLFVTQSAPSDTAAIIVE 199 Query: 239 PIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCL 298 P+QGE G G++ +R+ CD G ++I DE+Q G GRTG+ ++ EH +V+PDIL Sbjct: 200 PVQGEYGYYPATEGFMQGLRERCDRHGIVLICDEIQAGYGRTGQFWSHEHFDVRPDILIT 259 Query: 299 AKALGGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQ 358 AK L G P+ A A+ ++ F P T+G N +ACAAALAT++V ++NL A Sbjct: 260 AKGLASG-YPLSAIAASADLMKQGF--PGSQGGTYGANAVACAAALATLDVFEQENLLAN 316 Query: 359 AEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDN------EIGYNFASEMFRQR 412 + G L +L Y + E RG G+++ +E VD+ E E Sbjct: 317 VRENGAYLRQQLERLQSAY-RFIDEIRGMGLMLGMEIVDDKKQPSGERAAQLLKESEAAG 375 Query: 413 VLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKAL 449 +L+ + + +R PPL +T EQ + + +AL Sbjct: 376 LLMLRCGTHGQVVRWLPPLIVTREQIDEAVGLFEQAL 412 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 415 Length adjustment: 32 Effective length of query: 427 Effective length of database: 383 Effective search space: 163541 Effective search space used: 163541 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory