Align phosphomannomutase (EC 5.4.2.8) (characterized)
to candidate WP_022948269.1 H035_RS0106975 phosphomannomutase/phosphoglucomutase
Query= BRENDA::P26276 (463 letters) >NCBI__GCF_000421465.1:WP_022948269.1 Length = 810 Score = 383 bits (983), Expect = e-110 Identities = 208/459 (45%), Positives = 283/459 (61%), Gaps = 10/459 (2%) Query: 8 TLPASIFRAYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQ 67 TLP +FR I GVVG+TLT E+ +GRAIGSES +RG+ VAVGRD R S LV+ Sbjct: 354 TLPEVVFRPSAIAGVVGETLTPESVRELGRAIGSESESRGQQMVAVGRDARASSEALVQA 413 Query: 68 LIQGLVDCGCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLA 127 L +GL G V D+G VPT V+ +A + L +GVM+T +PP+YNG K+VV GE Sbjct: 414 LSEGLRASGRDVIDLGKVPTAVVNFATHYLPNCAGVMVTAGSDPPEYNGLKVVVGGEPCG 473 Query: 128 NEQIQALRERIEKNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVI 187 + + AL R++K DL+SG+G +E D+L Y I DD+ + +P+KVVVD G GVAG + Sbjct: 474 EKALLALNRRLQKGDLSSGMGMLESRDLLADYIGAIIDDVQIGRPLKVVVDYGPGVAGQV 533 Query: 188 APQLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAE-NADLGLAFDGDGD 246 AP L+ LGC V L+ + N P P L LI KV+ + +LGLAFDGDG+ Sbjct: 534 APALLRTLGCEVEELHTQGALN-------PFAPGALDRLIGKVREDREVELGLAFDGDGN 586 Query: 247 RVGVVTNTGTIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKT 306 R+ VV G I PDR+LML A DV+SR PG DI+FD++C+R L I +GGRPV+ + Sbjct: 587 RLAVVDAQGEPIMPDRVLMLLAADVLSREPGGDIVFDIQCSRHLAGHIVQHGGRPVVTPS 646 Query: 307 GHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSA 366 G I+ KM E GA+L G G + F+ERW G D IY AARL+E+LS + S+ +F+ Sbjct: 647 GDGPIRAKMAELGAVLGGGFDGSLLFQERWTGLSDAIYGAARLVEVLSAEPLTSDEIFAE 706 Query: 367 FPSDISTPEINITVTEDSKFAIIEAL--QRDAQWGEGNITTLDGVRVDYPKGWGLVRASN 424 P I TP +++ ++ +++ L D + + I TLDG+R DY GWG+V S Sbjct: 707 LPQGIVTPRLHVDLSPGEPETMMQVLVASSDKFFRDAKINTLDGIRADYADGWGVVSVSK 766 Query: 425 TTPVLVLRFEADTEEELERIKTVFRNQLKAVDSSLPVPF 463 + P LV RFEAD EE L RI+ FR + ++ L +PF Sbjct: 767 SVPGLVFRFEADNEEALFRIQGYFREWFETLEIDLDLPF 805 Lambda K H 0.319 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 892 Number of extensions: 51 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 810 Length adjustment: 37 Effective length of query: 426 Effective length of database: 773 Effective search space: 329298 Effective search space used: 329298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory