Align Putrescine aminotransferase; PAT; PATase; EC 2.6.1.82; Cadaverine transaminase; EC 2.6.1.-; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase (uncharacterized)
to candidate WP_022949003.1 H035_RS0110875 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= curated2:B7LZM2 (459 letters) >NCBI__GCF_000421465.1:WP_022949003.1 Length = 430 Score = 171 bits (434), Expect = 3e-47 Identities = 120/332 (36%), Positives = 177/332 (53%), Gaps = 23/332 (6%) Query: 82 QEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQP-LHSQELLDPLRAMLAKTVAALTPGK 140 +E ID + + G+ +P + +AV+ QL K + L L + + LTP Sbjct: 45 RELIDGMASWWCAIHGYNHPRLNAAVEAQLGKMAHVMFGGLTHEPAIELGERLVNLTPTP 104 Query: 141 LKYSFFCNSGTESVEAALKLAKAYQSPRG---KFTFIATSGAFHGKSLGALSATAKST-F 196 L F C+SG+ +VE ALK+A Y RG K F+A G +HG +LGA++ T Sbjct: 105 LDKVFLCDSGSVAVEVALKMALQYWQARGNSGKKRFLALRGGYHGDTLGAMTVCDPVTGM 164 Query: 197 RKPFMPLLP----------GFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPI-QGEGG 245 F LP GF H P+ + EA++ ++ ++AAVILEPI QG GG Sbjct: 165 HHLFSDFLPRQLFAPHPSCGF-HDPW-DPEAIQPLAELLERRHHELAAVILEPIVQGAGG 222 Query: 246 VILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGG 305 + P YL AVR+LCDE+ L+I DE+ TG GRTG++FAC+H ++ PDILC+ KA+ GG Sbjct: 223 MRFYHPEYLKAVRQLCDEYEVLLIADEIATGFGRTGRLFACQHADIAPDILCVGKAITGG 282 Query: 306 VMPIGATIATEEVFSVLFDNP---FLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQK 362 + + AT+ T + + F+H TF NPLACA A A+I++LLE + ++ ++ Sbjct: 283 YLTLAATLTTPNIAETIGQGEAGCFMHGPTFMANPLACAVASASIDLLLESDWQSRVKRI 342 Query: 363 GDMLLDGFRQLAREYPDLVQEARGKGMLMAIE 394 L G A V+E R G + +E Sbjct: 343 ETGLRRGLAPCAELAS--VKEVRVLGAIGVVE 372 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 430 Length adjustment: 32 Effective length of query: 427 Effective length of database: 398 Effective search space: 169946 Effective search space used: 169946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory