Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate WP_022949133.1 H035_RS0111545 citrate synthase
Query= BRENDA::Q9I5E3 (375 letters) >NCBI__GCF_000421465.1:WP_022949133.1 Length = 436 Score = 185 bits (470), Expect = 2e-51 Identities = 122/384 (31%), Positives = 202/384 (52%), Gaps = 30/384 (7%) Query: 19 QTALSTVGQEGAGLTYRGYDVRDLAAAAIFEEVAYLLLYGELPNKQQLDAYLKKLQGQRD 78 Q+A++ + E L YRGY + LA + F EVA+LL++GELP +L A+ +++ + Sbjct: 56 QSAITYIDGEQGILLYRGYPIEQLAQQSTFLEVAHLLIFGELPKPAELSAFAAEIKREAM 115 Query: 79 LPQALKEVLERIPKDAHPMDVMRTGASVLGTLEP----ELSF---DQQRDVADRLLAAFP 131 + + L++ + DAHPM +M V+G+L EL + +R A RLLA P Sbjct: 116 IHETLRKFFDGFQYDAHPMAMM---VGVVGSLSAFYHSELDMTDPEHRRISAIRLLAKMP 172 Query: 132 AIMTYWYRFT----HEGQRIDCNSDEPTIGGHF-LALLHGKKPSELHV-----KVMNVSL 181 I T YR + R D E + F L L ++ ++ + +++ Sbjct: 173 TIATACYRHSVGLPFVYPRGDLGYCENFLNMMFSLPSLQYSGDTQWYLDPLASEALSLLF 232 Query: 182 ILYAEHEFNASTFTARVCASTLSDLYSCVTGAIGSLRGPLHGGANEAAMELIERFSSPQE 241 IL+A+HE NAST T R+ +ST ++ Y+C++ I +L GP HGGANEA + ++ P Sbjct: 233 ILHADHEQNASTSTVRLASSTGANPYACISAGIAALWGPAHGGANEAVLGMLNEIGHPDR 292 Query: 242 ATAELLKMLERKD--KIMGFGHAIYKDSDPRNEVIKGWSKQL------ADEVGDKVLFAV 293 + + ++ D ++MGFGH IYK+ DPR +I+ + +D + D + Sbjct: 293 IPEYIRRAKDKNDPFRLMGFGHRIYKNYDPRAMIIRKACHAVLERFSQSDPLFDLAMALE 352 Query: 294 SEAIDKTMWEQKKLFPNADFYHASAYHFMGIPTKLFTPIFVCSRTSGWTAHVFEQRAN-- 351 A++ + +K+L+PN DFY Y + IP +FT +F +RT+GW AH E +++ Sbjct: 353 EMALNDDYFIEKRLYPNVDFYSGIIYKALNIPVNMFTVMFALARTAGWVAHWLELKSDPK 412 Query: 352 NRIIRPSAEYTGVEQRAFVPLEQR 375 +I RP Y G +R +V ++R Sbjct: 413 QKIGRPRQLYVGAPRRDYVSQDRR 436 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 375 Length of database: 436 Length adjustment: 31 Effective length of query: 344 Effective length of database: 405 Effective search space: 139320 Effective search space used: 139320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory