Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate WP_022949156.1 H035_RS0111660 branched-chain-amino-acid transaminase
Query= CharProtDB::CH_012531 (298 letters) >NCBI__GCF_000421465.1:WP_022949156.1 Length = 292 Score = 246 bits (628), Expect = 4e-70 Identities = 133/281 (47%), Positives = 174/281 (61%), Gaps = 1/281 (0%) Query: 7 FLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEIP 66 ++NG +P + A V V DHG LYGDGVFEGIR Y FRL HL RL +S +I L +P Sbjct: 8 WINGRLLPGNAATVPVTDHGLLYGDGVFEGIRFYRRRAFRLAAHLQRLADSCAAIRLTLP 67 Query: 67 YSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFPQE 126 + +T V E I +GY+RL+V+RG+G +GL+P+ CT+PNV++IA +L L + Sbjct: 68 CPRERLTRAVEEVIAAFAEDDGYLRLIVTRGSGPMGLNPEDCTRPNVILIATRLQLVSER 127 Query: 127 YYEKGIPVVTVATRRNRPDVLSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGYVAEG 186 +G+ V+ ATRR D L P++KSLNYLN IL R+EA AG EA+MLN G +AEG Sbjct: 128 KRREGVRVIIAATRRLPADGLDPRIKSLNYLNPILARMEAHQAGADEAVMLNRAGRIAEG 187 Query: 187 SGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVADEVFL 246 + DNVF+V+ +L TPP GAL GITR I+ + G V E +D+Y A E FL Sbjct: 188 TADNVFVVRQGELATPPPVEGALAGITRELIMGLARDAGISVAEIPLAPYDLYTAGECFL 247 Query: 247 TGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLEEFRKLVIED 287 TGT AE+I V VDGR +G GP L F LV E+ Sbjct: 248 TGTGAELIPVAEVDGRPMG-DCPGPVFLELRRRFHALVQEE 287 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 292 Length adjustment: 26 Effective length of query: 272 Effective length of database: 266 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_022949156.1 H035_RS0111660 (branched-chain-amino-acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
../bin/blast/fastacmd -i /tmp/list.3472.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.3472.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.