Align Probable 5-dehydro-4-deoxyglucarate dehydratase; EC 4.2.1.41; 5-keto-4-deoxy-glucarate dehydratase; KDGDH (uncharacterized)
to candidate WP_022949285.1 H035_RS0112360 4-hydroxy-tetrahydrodipicolinate synthase
Query= curated2:A4YNH1 (314 letters) >NCBI__GCF_000421465.1:WP_022949285.1 Length = 291 Score = 96.7 bits (239), Expect = 6e-25 Identities = 93/290 (32%), Positives = 129/290 (44%), Gaps = 20/290 (6%) Query: 22 VTPFKADYSFDETTYRSNMDWLCGYDVAGLFAAGGTGEFFSLTAAEVPEVVKVAVDETKG 81 VTP D +E+ R +++ + A G TGE +LT E +V++ VD+++G Sbjct: 10 VTPMDPDGGLNESALRKLVEFHIEAGTDAIVAVGTTGESATLTHDEHHQVIRWVVDQSRG 69 Query: 82 RVPVLAGTG-YGTAIAREIAMSAEKAGADGLLLLPPYLMHAEQEGLAAHVEAVCKSVKIG 140 RVPV+AGTG T A E+ A GAD LLL PY QEGL H +AV ++V I Sbjct: 70 RVPVIAGTGSNATREAIELTRKAADLGADACLLLTPYYNKPTQEGLYRHYKAVAEAVAIP 129 Query: 141 VIVYN---RDNAILQPDTLARLCERCPNLVGYKDGIGDIELMTRVYTKM-GDRLTYIGGL 196 I+YN R L P+T+ARL N+VG K+ D TR ++ D Y G Sbjct: 130 QILYNVPGRTACDLHPETVARLA-AIDNIVGIKEASPDPVARTRELQRLCPDFPRYSGDD 188 Query: 197 PTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRD---HATIHAGLKDFILPLI 253 A L G S N P A D A++ A L L Sbjct: 189 HAARQICLD----GGAGVISVTANVAPRLMREMVVAALAGDAKMAASVDAKLAALHRTLF 244 Query: 254 AIRNRKKGYAVSIIKAGMKVIGRDSGPVRLPLTDLTEAEMAEL-TALVKA 302 N +K + +G +RLPLT L+E E+ +AL++A Sbjct: 245 LESNPIP------VKWALHAMGLIPHGIRLPLTWLSERYHPEVRSALIEA 288 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 291 Length adjustment: 27 Effective length of query: 287 Effective length of database: 264 Effective search space: 75768 Effective search space used: 75768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory