Align Methylglutaconyl-CoA hydratase, mitochondrial; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding enoyl-CoA hydratase; muAUH; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 (characterized)
to candidate WP_022950068.1 H035_RS0116520 crotonase
Query= SwissProt::Q9JLZ3 (314 letters) >NCBI__GCF_000421465.1:WP_022950068.1 Length = 677 Score = 109 bits (272), Expect = 2e-28 Identities = 76/200 (38%), Positives = 106/200 (53%), Gaps = 6/200 (3%) Query: 52 LRVRHLEEENRGIVVLGINRAYGK-NALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPG 110 LR L+ +N+GI L + A N LS ++L L +D + R ++I S+ P Sbjct: 4 LRHFRLKTDNQGIAWLHFDHAESNANVLSADVLAELGSVLDRFHKNPP-RGLVILSDKPS 62 Query: 111 IFCAGADLKERAKMHSSEVG-PFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALAC 169 F AGAD+KE ++ + + +A LP PT+A I G LGGGLELALAC Sbjct: 63 GFIAGADVKEFIQLTERHRALSLIQVAHKRLQSLATLPCPTVARIHGYCLGGGLELALAC 122 Query: 170 DIRVAASSAK--MGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVG 227 RVA AK +GL E L I PG GG+ RL R IG A +L+ S R +D +A +G Sbjct: 123 RYRVALDDAKTRLGLPEVLLGIHPGFGGSVRLIRRIGAPAAFQLMLSGRTVDAAKAARLG 182 Query: 228 LISHVLEQNQEGDAAYRKAL 247 L+ H + + + D A R+ L Sbjct: 183 LVDHAVPE-RHWDRACRQIL 201 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 677 Length adjustment: 33 Effective length of query: 281 Effective length of database: 644 Effective search space: 180964 Effective search space used: 180964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory