Align 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 (characterized)
to candidate WP_025272326.1 HALAL_RS0101600 3-isopropylmalate dehydratase small subunit
Query= SwissProt::Q8NQV7 (197 letters) >NCBI__GCF_000527155.1:WP_025272326.1 Length = 205 Score = 224 bits (570), Expect = 1e-63 Identities = 110/194 (56%), Positives = 138/194 (71%), Gaps = 1/194 (0%) Query: 4 FTTYTGVGVPLQRSNVDTDQIIPAVYLKRVTRTGFEDGLFSNWRQNDPNFVLNTDTYKNG 63 F +TG G PL+ SNVDTDQIIP+VYLKRVT+TGF D LF+ WR+ + +FVLN TY++ Sbjct: 9 FRVHTGAGAPLRYSNVDTDQIIPSVYLKRVTKTGFADALFAEWREQE-DFVLNDATYQDA 67 Query: 64 SVLVAGPDFGTGSSREHAVWALMDYGFRAVFSSRFADIFRGNSGKAGMLTGIMEQSDIEL 123 S+LVAG +FGTGSSREHAVWAL D GF V + RF DIFR NS K G+LT + +D+E Sbjct: 68 SILVAGTEFGTGSSREHAVWALKDGGFAVVIAPRFGDIFRNNSLKNGLLTIELPYADVEQ 127 Query: 124 LWKLMEQTPGLELTVNLEKQIVTAGDVVISFEVDPYIRWRLMEGLDDAGLTLRKLDEIED 183 LW +E P ++ V+LE+Q V D + FE D + RWRL+EGLDD LTLR I + Sbjct: 128 LWDAIEDKPDTQIIVDLERQRVEYADTAVEFEFDEFSRWRLLEGLDDIALTLRSESLIAE 187 Query: 184 YEAKRPAFKPRTNA 197 YE +RP +KPRT A Sbjct: 188 YELRRPTWKPRTQA 201 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 197 Length of database: 205 Length adjustment: 21 Effective length of query: 176 Effective length of database: 184 Effective search space: 32384 Effective search space used: 32384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_025272326.1 HALAL_RS0101600 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.15454.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.15454.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.