GapMind for catabolism of small carbon sources

 

Protein WP_025272420.1 in Haloglycomyces albus DSM 45210

Annotation: NCBI__GCF_000527155.1:WP_025272420.1

Length: 342 amino acids

Source: GCF_000527155.1 in NCBI

Candidate for 24 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arabinose catabolism araWsh hi Inner-membrane translocator (characterized, see rationale) 46% 81% 266.9 Galactofuranose transporter permease protein YtfT 47% 256.1
D-galactose catabolism ytfT hi Galactofuranose transporter permease protein YtfT (characterized) 47% 94% 256.1 Fructose import permease protein FruF 39% 229.9
D-fructose catabolism fruF lo Fructose import permease protein FruF (characterized) 39% 93% 229.9 Galactofuranose transporter permease protein YtfT 47% 256.1
sucrose catabolism fruF lo Fructose import permease protein FruF (characterized) 39% 93% 229.9 Galactofuranose transporter permease protein YtfT 47% 256.1
D-ribose catabolism rbsC lo ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized) 37% 94% 183.3 Galactofuranose transporter permease protein YtfT 47% 256.1
D-mannose catabolism HSERO_RS03645 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 38% 92% 175.6 Galactofuranose transporter permease protein YtfT 47% 256.1
D-fructose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 36% 87% 175.3 Galactofuranose transporter permease protein YtfT 47% 256.1
sucrose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 36% 87% 175.3 Galactofuranose transporter permease protein YtfT 47% 256.1
myo-inositol catabolism PS417_11895 lo Inositol transport system permease protein (characterized) 35% 93% 172.9 Galactofuranose transporter permease protein YtfT 47% 256.1
xylitol catabolism PS417_12060 lo ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 37% 90% 171.4 Galactofuranose transporter permease protein YtfT 47% 256.1
D-cellobiose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
D-glucose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
lactose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
D-maltose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
sucrose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
trehalose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
D-xylose catabolism xylH lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 93% 161.4 Galactofuranose transporter permease protein YtfT 47% 256.1
L-arabinose catabolism araZsh lo Inner-membrane translocator (characterized, see rationale) 36% 96% 155.6 Galactofuranose transporter permease protein YtfT 47% 256.1
D-fructose catabolism fruG lo Fructose import permease protein FruG (characterized) 33% 91% 145.6 Galactofuranose transporter permease protein YtfT 47% 256.1
sucrose catabolism fruG lo Fructose import permease protein FruG (characterized) 33% 91% 145.6 Galactofuranose transporter permease protein YtfT 47% 256.1
D-xylose catabolism xylF_Tm lo ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized) 33% 94% 145.2 Galactofuranose transporter permease protein YtfT 47% 256.1
D-galactose catabolism yjtF lo Inner membrane ABC transporter permease protein YjfF (characterized) 32% 94% 129.8 Galactofuranose transporter permease protein YtfT 47% 256.1
L-fucose catabolism HSERO_RS05255 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 30% 87% 128.6 Galactofuranose transporter permease protein YtfT 47% 256.1
2'-deoxyinosine catabolism H281DRAFT_01115 lo deoxynucleoside transporter, permease component 1 (characterized) 31% 85% 117.5 Galactofuranose transporter permease protein YtfT 47% 256.1

Sequence Analysis Tools

View WP_025272420.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLKQFTGTYARRLMWPGLVLVALIVVNIAFTGFGFLTPEIVDGRMSGPFVTVLRNSVPLL
MVALGMTLVIATKGIDLSVGAVYAIGAAVAVQYLATGSQNSLGSVLVAIALGLGVAAVIG
AWNGTMVSVFGVQPIIATLIFMIAGRGVAQLITGGQIPNVADSSPFVNLGRGEILSIPLP
IIIGVAVCAVLMVATRRTAFGVLLESVGGNPKASRLAGIRAREMTILVYLICGLLAGLAG
IISAANIGGADANNGGLWIELDAILAVVIGGTALTGGRFYLLGTVFGVVIIKLLEVTIIN
VGLSSQWQFTAKALVVFAVALLQSPQFRTWLTKPFQKKAVAA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory