Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_026127525.1 D471_RS0108135 acetolactate synthase small subunit
Query= BRENDA::P9WKJ3 (168 letters) >NCBI__GCF_000341125.1:WP_026127525.1 Length = 174 Score = 202 bits (513), Expect = 3e-57 Identities = 101/160 (63%), Positives = 130/160 (81%) Query: 5 THTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQIT 64 +HTLSVLVED PG+LAR ++LFSRRGFNI+SL+V TE SRMTIVV+ + PLEQ+T Sbjct: 3 SHTLSVLVEDTPGILARASSLFSRRGFNIDSLSVSTTEYAGLSRMTIVVNCDLHPLEQVT 62 Query: 65 KQLNKLINVIKIVEQDDEHSVSRELALIKVQADAGSRSQVIEAVNLFRANVIDVSPESLT 124 KQLNKL+NV+KIVE D SV REL L+KV+ADA SR+ V++ LFRA+V+DVSP+ + Sbjct: 63 KQLNKLVNVVKIVEMDTTASVQRELLLVKVKADASSRTHVLQTAELFRAHVVDVSPDVVV 122 Query: 125 VEATGNRGKLEALLRVLEPFGIREIAQSGMVSLSRGPRGI 164 +EATG+ KL+AL++ LEPFGIRE+ +SG+V+L RGPR I Sbjct: 123 IEATGDPEKLDALVKNLEPFGIRELVKSGLVALGRGPRSI 162 Lambda K H 0.315 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 174 Length adjustment: 18 Effective length of query: 150 Effective length of database: 156 Effective search space: 23400 Effective search space used: 23400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_026127525.1 D471_RS0108135 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.22532.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.22532.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.