Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate WP_026223250.1 A3OW_RS0101500 imidazole glycerol phosphate synthase subunit HisH
Query= reanno::HerbieS:HSERO_RS20325 (212 letters) >NCBI__GCF_000372865.1:WP_026223250.1 Length = 218 Score = 223 bits (569), Expect = 2e-63 Identities = 108/211 (51%), Positives = 144/211 (68%), Gaps = 3/211 (1%) Query: 1 MNKIVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSL 60 M+ + V+DYGMGNL S+A+AL+H P A V + + I ADR+V PG GA+ DCM +L Sbjct: 1 MSSVAVIDYGMGNLHSIAKALQHAVPAATVICTSDRDAILNADRIVFPGVGAIRDCMNAL 60 Query: 61 RESGVQDAVIEASRTKPLFGVCVGEQMLFDWSEE-GDTPGLGLLPGKVVRFDLEGMRQDD 119 ++G+ + V +A+R KP G+C+G Q L SEE G T GLG+ G+VVRF + ++ D Sbjct: 61 NQAGLSEVVQKAARLKPFLGICLGMQALLTESEENGGTAGLGVFSGRVVRFP-DHLQDAD 119 Query: 120 GSLFKVPQMGWNHVHQTSRHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFAC 179 G+ K+P MGWN VHQT HPLW I N+ FYFVHSYYA P +++ V Y FAC Sbjct: 120 GNTLKIPHMGWNQVHQTP-HPLWHNIPQNSRFYFVHSYYAQPEDASVVAATADYPEAFAC 178 Query: 180 AVARDNIFATQFHPEKSASAGLQLYRNFVHW 210 A+A DN+FA QFHPEKS +AGLQL +NF++W Sbjct: 179 AIAEDNVFAVQFHPEKSQAAGLQLLKNFLNW 209 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 218 Length adjustment: 22 Effective length of query: 190 Effective length of database: 196 Effective search space: 37240 Effective search space used: 37240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_026223250.1 A3OW_RS0101500 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.24292.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.24292.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.