Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_026608423.1 METAC_RS0120250 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000427445.1:WP_026608423.1 Length = 262 Score = 126 bits (316), Expect = 5e-34 Identities = 75/248 (30%), Positives = 128/248 (51%), Gaps = 15/248 (6%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 +L++ LSV +G + AV + V G + LIG NGAGKTT ++G VR S+G+I Sbjct: 5 LLQISGLSVRFGGLTAVDRLDLTVEAGAIHGLIGPNGAGKTTAFNLIAGAVRRSAGEIRL 64 Query: 63 LGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLK---------------K 107 G ++ +P V GL++ + +F +T +EN+ G + + Sbjct: 65 DGAPVEGLPPYARVRRGLARTFQNIRLFGEMTALENILAGMHTRLKGSLFEILLRPDKTR 124 Query: 108 NREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGL 167 E + + F L + A LS G+Q+ + + RAL + PKLLLLDEP+ G+ Sbjct: 125 RVERDAVTEARALLDFVGLAAVARRRAGELSYGDQRRVEIARALAAAPKLLLLDEPAAGM 184 Query: 168 APIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSE 227 P + + +++Q ++ +G TVLL+E + + + D+ VL G+ + G +E+ + Sbjct: 185 NPAETRALSELLQRVKARGVTVLLVEHDMGLVMRLCDKITVLNFGRKIAEGAPREIRADR 244 Query: 228 EVRKAYLG 235 +V +AYLG Sbjct: 245 QVIEAYLG 252 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 262 Length adjustment: 24 Effective length of query: 212 Effective length of database: 238 Effective search space: 50456 Effective search space used: 50456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory