Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_026608424.1 METAC_RS0120255 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000427445.1:WP_026608424.1 Length = 281 Score = 171 bits (434), Expect = 1e-47 Identities = 96/265 (36%), Positives = 158/265 (59%), Gaps = 6/265 (2%) Query: 35 YVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAM 94 Y +L +G+N +LA+ + +++ GQ SLG A FM +GAYA+A++ K A F A+ Sbjct: 11 YQNLLASLGVNGLLALSMYVVLAI-GQLSLGQAAFMGLGAYASALLTLK---LDAPFPAV 66 Query: 95 LVGALL-SGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPN 153 + ++L AVAL++G PTLRL G YLA+AT+ + EI+R+ ++ LT GA G+ GIP Sbjct: 67 IAASMLVPAAVALVIGAPTLRLSGVYLALATVSLGEILRVVLVES-DLTGGALGLSGIPE 125 Query: 154 FTTWQMVYFFVVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAI 213 +++ + + +A RS IGR+ ++REDEIAA + G++ K+ A V A+ Sbjct: 126 KAGLPLIFACLALALVAFTLICRSRIGRAMEAIREDEIAASASGIDLPAYKMAALVASAM 185 Query: 214 TASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQD 273 A +AG+L A + P +Y F ++ +L + GG+GS G ++ A +L +L LL+ Sbjct: 186 LAGLAGALNAHISSFISPNEYGFDAAVTILSFALLGGIGSPFGPVIGAFILTLLPELLRP 245 Query: 274 VASVRMIIYALALVLVMIFRPGGLL 298 + R+++ L +V ++F P GLL Sbjct: 246 LHDYRLVVNGLIIVFAVLFMPHGLL 270 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 281 Length adjustment: 27 Effective length of query: 291 Effective length of database: 254 Effective search space: 73914 Effective search space used: 73914 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory