Align Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale)
to candidate WP_027178537.1 G496_RS0106325 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A0D9B2B6 (307 letters) >NCBI__GCF_000429985.1:WP_027178537.1 Length = 300 Score = 277 bits (708), Expect = 3e-79 Identities = 142/296 (47%), Positives = 205/296 (69%), Gaps = 7/296 (2%) Query: 6 HFFQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFIAIAGLAMMGL 65 +FFQQL+NG+T+G YALIA+GYTMVYGII +INFAHGE + G YV I ++ LA G Sbjct: 3 YFFQQLINGVTLGGIYALIALGYTMVYGIIQLINFAHGEFFAAGGYVGVIFMSYLAAQGA 62 Query: 66 DSVPLLMTAAFIASIVVTSSYGYSIERIAYRPLRGSNRLIPLISAIGMSIFLQNTVLLSQ 125 + L + + + ++ + ++E++AY+PLR S+RL L+SA+GMSIFLQN ++L+Q Sbjct: 63 P-IWLCLGGSLLLTMCYCAMLAMAVEKVAYKPLRNSSRLSVLLSALGMSIFLQNGLMLTQ 121 Query: 126 DSKDKSIPN-LIPGNFAIGPGGAHEVLISYMQIVVFVVTLVAMLGLTLFISRSRLGRACR 184 DK+ P+ L G F G V++SYMQI +F +T ++ L + ++R+G+A R Sbjct: 122 GVYDKAYPSELTSGGFEFGT-----VMLSYMQIFIFCITAFLLVALNTLVFKTRIGKAMR 176 Query: 185 ACAEDIKMANLLGINTNNIIALTFVIGAALAAIAAVLLSMQYGVINPNAGFLVGLKAFTA 244 + A+D M+ L+GIN+N II+LTF IGA LAA A +++ + YG + + GF+ G+KAF A Sbjct: 177 STAQDKIMSALVGINSNRIISLTFAIGAGLAAAAGIMVGLYYGSVRYDMGFVPGIKAFAA 236 Query: 245 AVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGILG 300 AVLGGIG+I GAM+GG ++G+ E F A +YKDV AF +L+ VL FRPTGI+G Sbjct: 237 AVLGGIGNITGAMIGGFIIGMVEIFAAGYISGEYKDVFAFIILIAVLYFRPTGIMG 292 Lambda K H 0.327 0.144 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 300 Length adjustment: 27 Effective length of query: 280 Effective length of database: 273 Effective search space: 76440 Effective search space used: 76440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory