Align Aldehyde dehydrogenase; NAD/NADP-dependent aldehyde dehydrogenase; EC 1.2.1.3; EC 1.2.1.4 (characterized)
to candidate WP_027179997.1 G496_RS0115120 NAD-dependent succinate-semialdehyde dehydrogenase
Query= SwissProt::Q8GAK7 (458 letters) >NCBI__GCF_000429985.1:WP_027179997.1 Length = 455 Score = 390 bits (1002), Expect = e-113 Identities = 205/455 (45%), Positives = 292/455 (64%), Gaps = 4/455 (0%) Query: 1 MAIATIDPTTGITLKTFDAHTPEEVENRIARAEAAFRSLQNTSFEERARWMHKAADILES 60 M+I +++P T + TF+A++ E+V++ + AA+ + S+ ER + KAA+IL Sbjct: 1 MSIQSLNPATEEVVATFEAYSDEKVQSILDLTAAAWADWKEKSYSERKVLLKKAAEILRE 60 Query: 61 EADEVARLIATEMGKTLTTAKYEALKSATGMRHFADHAQRYLSPETPVPASEVNASNLHV 120 + E+AR+ A EMGK + K EA K A ++A+ + L+PE P S+ A ++V Sbjct: 61 RSVELARIAAVEMGKPVKLGKAEAEKCALVCDYYAEEGEAMLAPE---PVSDA-AKKVYV 116 Query: 121 QFDPLGVVLAVMPWNYPLWQAVRFAAPALMAGNTGLLKHASNVPQCALYLGDLFARGGFP 180 +FDPLG VL VMPWN+P WQ R AAP+LMAGN +LKHASNVPQCAL + +F GFP Sbjct: 117 RFDPLGTVLTVMPWNFPFWQVFRIAAPSLMAGNCVVLKHASNVPQCALTIEKIFKDAGFP 176 Query: 181 EGAFQTLLVEGKDVIPLVDDARIRAVTLTGSVAAGSAIAEAAGRNIKRSVLELGGMDVFI 240 + F+TLL+ V ++D + AV+LTGS AG ++A AAG +K+SV+ELGG D I Sbjct: 177 DNVFRTLLIGSDQVEAVLDHDSVFAVSLTGSEGAGKSVASAAGARLKKSVMELGGSDPLI 236 Query: 241 VMPSADIEKAAAQAVIARLQNSGQSCIAAKRFYVHEDVYDRFEHLFVTGMAEAVAGDPLD 300 V+ AD++KAA A ++R N+GQ+CIAAKRF V +VYD F M+ GDPLD Sbjct: 237 VLADADVKKAAETAAVSRCGNAGQACIAAKRFIVMAEVYDEFIEQLKLSMSAYKPGDPLD 296 Query: 301 ESTSFGPLATERGRQDVHELVRDAREKGAAVQCGGEIPEGEGWYYPATVLTGVTEDMRIY 360 +T GP++++ R+ + + V+ E G V G +PEG+G+YY T++ V D + Sbjct: 297 PATEMGPMSSKGLRETLEDQVKRCVEAGGKVLSLGSMPEGKGFYYLPTIIENVPVDSDVC 356 Query: 361 REECFGPVACLYKVSSLQEAIALSNDSDFGLSSSVWTNDETEATEAARSIEAGGVFINGL 420 +EE FGP A ++KVSS+ EAI L+ND+ FGL S+W+ + A + A I G V+IN L Sbjct: 357 QEEFFGPAALVFKVSSIDEAIRLANDTPFGLGGSIWSANIPLAEKLAAKIRTGNVYINAL 416 Query: 421 TASFPAVPFGGLKDSGYGRELSAYGIREFVNIKTV 455 S VPFGG+ SG+GREL +YGIREFVN+K+V Sbjct: 417 VRSDVHVPFGGVGISGFGRELGSYGIREFVNVKSV 451 Lambda K H 0.317 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 455 Length adjustment: 33 Effective length of query: 425 Effective length of database: 422 Effective search space: 179350 Effective search space used: 179350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory