Protein WP_027180502.1 in Desulfovibrio bastinii DSM 16055
Annotation: NCBI__GCF_000429985.1:WP_027180502.1
Length: 398 amino acids
Source: GCF_000429985.1 in NCBI
Candidate for 12 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-alanine catabolism | braC | med | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized) | 39% | 93% | 236.5 | leucine-specific-binding protein LivK | 37% | 222.6 |
L-isoleucine catabolism | livJ | med | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized) | 39% | 93% | 236.5 | | | |
L-leucine catabolism | livJ | med | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized) | 39% | 93% | 236.5 | | | |
L-serine catabolism | braC | med | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized) | 39% | 93% | 236.5 | leucine-specific-binding protein LivK | 37% | 222.6 |
L-threonine catabolism | braC | med | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized) | 39% | 93% | 236.5 | leucine-specific-binding protein LivK | 37% | 222.6 |
L-valine catabolism | livJ | med | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized) | 39% | 93% | 236.5 | leucine-specific-binding protein LivK | 37% | 222.6 |
L-phenylalanine catabolism | livJ | med | Leucine ABC transporter subunit substrate-binding protein LivK (characterized, see rationale) | 35% | 91% | 226.9 | BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC | 32% | 173.7 |
D-alanine catabolism | AZOBR_RS08260 | lo | Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale) | 34% | 95% | 203 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein | 39% | 236.5 |
L-proline catabolism | AZOBR_RS08260 | lo | Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale) | 34% | 95% | 203 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein | 39% | 236.5 |
L-arginine catabolism | braC | lo | BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized) | 33% | 88% | 176.8 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein | 39% | 236.5 |
L-glutamate catabolism | braC | lo | BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized) | 33% | 88% | 176.8 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein | 39% | 236.5 |
L-histidine catabolism | braC | lo | BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized) | 33% | 88% | 176.8 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein | 39% | 236.5 |
Sequence Analysis Tools
View WP_027180502.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKRSLVLLVVVLMFSIGLMGCSQEKKEQTPAKKETAEKTVEKTEAAPAGGEIILGVPGAH
SGDLASYGLPTVAAAELVAKSYNDKGGVNGMKVVVAPQDDQCKPELATNAAFKLVSDKVT
IVLGHICSGATKAALPIYKEANIVCLSPSATNPPLTQSGDYPNFFRTIASDDAQAALAAK
FAMEDLHLKKIAVIHDKGDYGKGFAEFAKKFVEEAKDHEVILFEGITPGAVDYSAVVQKI
KSSGADGVIFGGYHPEASKIIMQMRKKTLDIPFISDDGVKAQTFIDTAGAAAEGVYATGP
RDITANPLYAVAHQGFLDTHEGKEPGAFYYEAYSGAIALLNAIEKAGSTDYDKIVDALHN
NLVETPVGKIKFDSKGDAIGVGFSVYQVHDGQYVEVKK
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory