Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_027456474.1 K420_RS0101385 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000519045.1:WP_027456474.1 Length = 264 Score = 138 bits (348), Expect = 1e-37 Identities = 89/261 (34%), Positives = 136/261 (52%), Gaps = 6/261 (2%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKA 60 M +ENI V +TLNRP LN+ A+ EL AL AD +I +V+TG+ +A Sbjct: 1 MNFENITFTVEAGVARLTLNRPDKLNSFTGAMHAELRTALDAIQADASIRVLVLTGAGRA 60 Query: 61 FAAGADIGM--MSTYTYMDVYKGDYITRNWETV----RSIRKPIIAAVAGFALGGGCELA 114 F AG D+ M+ G+ + RN++ + +++R P IAAV G A G G +A Sbjct: 61 FCAGQDLADPDMAKVDGKMPDIGNVVERNYKPLVLRLQNLRVPTIAAVNGIAAGAGASVA 120 Query: 115 MMCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERA 174 + CD++ A +A F Q K+G++P GGT LP+ V A+AM L L A + A +A Sbjct: 121 LACDLVVATKSASFLQAFSKIGLIPDTGGTWFLPQRVGMARAMGLALLADKLPAEKAAEW 180 Query: 175 GLVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSL 234 GL+ A A A ++ P+ A++ +++++ A TL + + FE L Sbjct: 181 GLIWECAEDAEFAARVDALAKQLSTLPTKALVRTRQAMHAAPGHTLEQQLSFEGGFMREL 240 Query: 235 FATEDQKEGMAAFVEKRKPVF 255 + D EG+ AF+EKR P F Sbjct: 241 GWSPDYAEGVQAFMEKRAPNF 261 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory