Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_027456719.1 K420_RS0102835 ABC transporter ATP-binding protein
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000519045.1:WP_027456719.1 Length = 357 Score = 420 bits (1080), Expect = e-122 Identities = 214/347 (61%), Positives = 258/347 (74%), Gaps = 15/347 (4%) Query: 13 VALLVLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYAVGAYLFA 72 VALL LP + G AWVRI D A+LYV LALGLNIVVG+AGLLDLGY+AFYAVGAY +A Sbjct: 18 VALLGLPFVAAMGGQAWVRILDFAILYVFLALGLNIVVGFAGLLDLGYIAFYAVGAYAWA 77 Query: 73 LMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAIVT 132 L+ASPH GLH +W+++P+ A LA G +LG+PTLKLRGDYLAIVT Sbjct: 78 LLASPHF-------------GLHLPIWVILPIGAGLACIAGVLLGSPTLKLRGDYLAIVT 124 Query: 133 LGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLYYYL 192 LGFGEI+RIF+NNL+ PVN+TNGP+G+ ID V G +VFG+ + YYYL Sbjct: 125 LGFGEIVRIFMNNLNAPVNITNGPQGITLIDPVAFGGFKFSGTTQVFGYALTGPMKYYYL 184 Query: 193 FLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGGVSG 252 + L ++ +II RLQ SRIGRAW AIREDEIAAKA+GINTRN+KLLAF MGASFGG++G Sbjct: 185 LVALAILVIIINLRLQHSRIGRAWQAIREDEIAAKAVGINTRNIKLLAFAMGASFGGIAG 244 Query: 253 AMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVAGPLQ 312 +F A QGFVSPESFSLMES+MI+AMVVLGG+GHIPGVILGAVLLS LPE LRY GP Q Sbjct: 245 GVFAAMQGFVSPESFSLMESIMILAMVVLGGMGHIPGVILGAVLLSILPEALRYGVGPAQ 304 Query: 313 AMTDGR--LDSAILRQLLIALAMIIIMLLRPRGLWPSPEHGKSLTQK 357 G+ +D LR L+ LA++++M +P GLWPSPE + L +K Sbjct: 305 MALFGKQLVDPESLRMLVFGLALVLVMRFKPAGLWPSPERKRELGEK 351 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 357 Length adjustment: 29 Effective length of query: 329 Effective length of database: 328 Effective search space: 107912 Effective search space used: 107912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory