Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_027457109.1 K420_RS0105085 ABC transporter permease
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_000519045.1:WP_027457109.1 Length = 951 Score = 222 bits (565), Expect = 3e-62 Identities = 115/248 (46%), Positives = 165/248 (66%), Gaps = 2/248 (0%) Query: 5 LLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFEL 64 LL+ +V+KRFGGL A N + + ++ G++ LIGPNGAGK+T FN I+ + G Sbjct: 703 LLEASEVTKRFGGLVANNNMSLNVKAGEVMALIGPNGAGKSTMFNCISAVNPATEGKIAF 762 Query: 65 DGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAR 124 G+ + ++A+ G++RTFQ++RL G M+VLENV +G H+R + V A R R Sbjct: 763 LGESTASLQARDIARRGMSRTFQHVRLLGNMSVLENVAIGAHLRGNKGVVSAALR--LDR 820 Query: 125 EEEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGM 184 EE + ++ + ++ VG+ + A L+ G QR +EIARALA+DP LL LDEPAAG+ Sbjct: 821 AEENRLLAEAARQIERVGLAEHMFEPAGSLALGQQRIVEIARALASDPCLLLLDEPAAGL 880 Query: 185 NATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQKNP 244 EK L ELL K++AEG ILL+EHD+ +MGL +RI V+++G+ IAEG+P +VQKNP Sbjct: 881 RYKEKQALAELLTKLRAEGMGILLVEHDMDFVMGLADRIVVMEFGEKIAEGLPEEVQKNP 940 Query: 245 AVIEAYLG 252 V+EAYLG Sbjct: 941 KVLEAYLG 948 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 593 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 951 Length adjustment: 34 Effective length of query: 221 Effective length of database: 917 Effective search space: 202657 Effective search space used: 202657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory