Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_027457181.1 K420_RS0105480 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000519045.1:WP_027457181.1 Length = 258 Score = 130 bits (328), Expect = 2e-35 Identities = 87/255 (34%), Positives = 131/255 (51%), Gaps = 10/255 (3%) Query: 10 TRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EKAFAAGAD-- 66 T G + +TLN P LNA++ A+ +L A+++ DDAI +V+ G+ + AFAAG D Sbjct: 8 TNGEIATLTLNNPDKLNAIDLAMWQQLAASMQRLAKDDAIRCVVIRGAGDAAFAAGGDLE 67 Query: 67 --IGMMSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDIIFAAD 124 + +T Y G+ + R + P +A + G +GGG E+A +CD+ A + Sbjct: 68 EFVTARATLDQALHYHGE-VARALNAIADCPHPTVALIKGACIGGGLEIAGVCDLRIAGE 126 Query: 125 TAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIPAA 184 + +FG P KLG G + L R A ++ L R ++A EA GL++RV+ Sbjct: 127 STRFGAPINKLGFSMYPGEMEGLLRLAGPAVIKEILLEGRILNAREAYEKGLLTRVVGDE 186 Query: 185 SLVDEAIAAAATIAEFPSPAVMMVKESVNRAYE-TTLAEGVHFERRLFHSLFATEDQKEG 243 + DEA A A I K+ + R + L+E ER + TED KEG Sbjct: 187 QVEDEAYATARRICSGAPLVAGWHKQWIRRLLDGRPLSEQ---ERADSFAFLDTEDYKEG 243 Query: 244 MAAFVEKRKPVFKHR 258 ++AF+EKRKPVFK R Sbjct: 244 LSAFLEKRKPVFKAR 258 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory