Align Peroxisomal multifunctional enzyme A; MFE-A; MFE-1; EC 1.1.1.35 (characterized)
to candidate WP_027458474.1 K420_RS0113145 3-oxoacyl-ACP reductase FabG
Query= SwissProt::Q9NKW1 (441 letters) >NCBI__GCF_000519045.1:WP_027458474.1 Length = 246 Score = 119 bits (297), Expect = 1e-31 Identities = 70/187 (37%), Positives = 100/187 (53%), Gaps = 8/187 (4%) Query: 7 DKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEE-IKAAGG 65 DK+ +VTGA GIG+ ALE ++GA V+ G+ T + + K + + E +K G Sbjct: 4 DKIALVTGATRGIGRAIALELGRQGATVI-----GTATSEDGAGKISAYLTESGVKGRG- 57 Query: 66 TAVANYDSVEDGEKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYRVHAKGA 125 V N + ++ G + IL+NNAGI RD +M D +WD V + K Sbjct: 58 -IVLNVTDAAQTDAVLADIAKELGAITILVNNAGITRDNLAMRMGDDEWDAVIDTNLKAV 116 Query: 126 YKLSRAAWNHMREKNFGRIIMTSSAAGLYGNFGQANYGSMKMALVGLSNTLAQEGKSKNI 185 ++LSR M + FGRI+ SS G GN GQANY + K + GLS +LA+E S+NI Sbjct: 117 FRLSRGVMRGMMKARFGRIVNISSVVGYSGNPGQANYCAAKAGVAGLSRSLARELGSRNI 176 Query: 186 HCNTIAP 192 N +AP Sbjct: 177 TVNCVAP 183 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 246 Length adjustment: 28 Effective length of query: 413 Effective length of database: 218 Effective search space: 90034 Effective search space used: 90034 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory