Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_027721379.1 H589_RS0107120 FAA hydrolase family protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000425265.1:WP_027721379.1 Length = 255 Score = 110 bits (274), Expect = 4e-29 Identities = 73/238 (30%), Positives = 118/238 (49%), Gaps = 20/238 (8%) Query: 64 TVQTLLSPLAPTDVPA-IRGMGLQYSGDPAN-PQDKPPVACLFFKASQALAGPGDDIVLP 121 T+ S + P VP+ I +GL Y + D +F K A+ G D IVLP Sbjct: 34 TIPLSESTVLPIVVPSKIICVGLNYKKHASELNMDLGDEPMIFLKPPSAIIGNNDAIVLP 93 Query: 122 RLARDEKNDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGLCAKGGQWGMGKS 181 + ++ DYE EL V++G+ K++ + + GY NDV++R K + K Sbjct: 94 --STSQQVDYEAELAVIIGQPIKNMPPEKIAPLIFGYACANDVTARDFQRKDTLFTRAKG 151 Query: 182 YDTWCPFGPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVLKIPELIARLSHGTTL 241 +DT+ P GPC+ + D L I T VN K+ Q+GNT+D++ +L++ +S TL Sbjct: 152 FDTFAPIGPCIET----SLDTTSLAIRTIVNDKVRQEGNTSDMLYTPIQLVSYISQIMTL 207 Query: 242 QAGSLILTGSPIALGRKAPGDAVEQSPFMKDGDEIRCFVEGCGTLINSVRDEAARPLP 299 G +I+TG+P +G + GD++ +EG GTL N+V + + +P Sbjct: 208 NPGDVIMTGTPDGIGT------------INAGDKVEIEIEGIGTLTNTVVSDESSKIP 253 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 255 Length adjustment: 26 Effective length of query: 282 Effective length of database: 229 Effective search space: 64578 Effective search space used: 64578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory