Align acetohydroxy-acid synthase small subunit (EC 2.2.1.6) (characterized)
to candidate WP_027722243.1 H589_RS0112015 acetolactate synthase small subunit
Query= metacyc::MONOMER-11901 (169 letters) >NCBI__GCF_000425265.1:WP_027722243.1 Length = 159 Score = 120 bits (302), Expect = 8e-33 Identities = 65/160 (40%), Positives = 102/160 (63%), Gaps = 3/160 (1%) Query: 1 MKNTHIISVLVLNKPGVLQRISGLFTRRWYNISSITGGSTDSTDISRMTIVVKGDDKVVE 60 MK T IS L+ N+PGVL S F NI+SI+ G T++ D+SRM I +G D + Sbjct: 1 MKRT--ISALIRNRPGVLAESSAAFLHHKINITSISCGETENMDVSRMVICAEGSDDDIS 58 Query: 61 QVVKQLNKLIEVIKVIDLDEEECVERELCLIKIYAPTESSKSQVIQYANIFRGNIVDLSQ 120 +V L + VI++ DL +E V+REL LIK+ + S SQ++Q +FR ++V + Q Sbjct: 59 KVTNDLLAMDFVIQLDDLARKEFVDRELVLIKVDV-DKDSMSQMMQIFEVFRADVVGMGQ 117 Query: 121 ESLTVQITGDKTKISAFIKLVKPMGIKEISRTGLTALMRG 160 +++TV+++GD+ ++ IK+++P GIK + RTG+ AL RG Sbjct: 118 KTITVELSGDQERVEGLIKILQPFGIKSMCRTGMIALKRG 157 Lambda K H 0.317 0.134 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 67 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 169 Length of database: 159 Length adjustment: 18 Effective length of query: 151 Effective length of database: 141 Effective search space: 21291 Effective search space used: 21291 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_027722243.1 H589_RS0112015 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.31281.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.31281.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.