Align Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized)
to candidate WP_027722302.1 H589_RS0112340 branched-chain amino acid ABC transporter substrate-binding protein
Query= SwissProt::P21175 (373 letters) >NCBI__GCF_000425265.1:WP_027722302.1 Length = 391 Score = 250 bits (638), Expect = 5e-71 Identities = 131/340 (38%), Positives = 198/340 (58%), Gaps = 2/340 (0%) Query: 25 MAADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQ 84 ++A TI + + G +G +A YG A + ++ +N AGG+NGAQ+ + DD C P+ Sbjct: 42 VSAKTILLGVPGAHSGDLASYGLPTVEAAKLVVKAVNDAGGINGAQVVLSMQDDQCKPEF 101 Query: 85 AVAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRG-YKLIFR 143 A A K+V+D V+GH+CS +T+ A IY++ ++ ++PSAT P +T G Y FR Sbjct: 102 ATNAAFKLVSDKATVVLGHICSGATKAALPIYKESNLVCMSPSATNPALTQSGDYPNFFR 161 Query: 144 TIGLDNMQGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKKTVEDAG-IKVAVFEGL 202 TI D+ Q +A KF E K IA++HDK YG+G A KK VE++G KVA+FEG+ Sbjct: 162 TIASDDAQAALASKFAMENLGLKNIAIIHDKGDYGKGFAEFAKKYVEESGSAKVALFEGV 221 Query: 203 NAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITA 262 G D++A++ K++ +G V FGGYHPE ++ Q ++ + F+ +GV Sbjct: 222 TPGAVDYSAVVQKIRASGADGVIFGGYHPEASKIVSQMRKKKMTVPFISDDGVKAKTFID 281 Query: 263 IAGDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAG 322 +A A+EG+ AT PR +P K ++ +KA ++ G F AYSA + K IE +G Sbjct: 282 VAAAAAEGVYATGPRDITANPMYKVALEQYKASHEGEPGAFFFEAYSAAIALLKAIENSG 341 Query: 323 EADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYE 362 D +K+ EALR + ETP G + FD KGD F+VY+ Sbjct: 342 STDYDKIVEALRTHEVETPVGKIKFDSKGDAIGVGFSVYQ 381 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 391 Length adjustment: 30 Effective length of query: 343 Effective length of database: 361 Effective search space: 123823 Effective search space used: 123823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory