Align Acetolactate synthase isozyme 1 small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase I small subunit; AHAS-I; ALS-I (uncharacterized)
to candidate WP_027722599.1 H589_RS0113930 acetolactate synthase small subunit
Query= curated2:P0ADG0 (96 letters) >NCBI__GCF_000425265.1:WP_027722599.1 Length = 88 Score = 81.6 bits (200), Expect = 2e-21 Identities = 37/78 (47%), Positives = 56/78 (71%) Query: 8 NVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMIS 67 N ++EL VRNH GVM+ + GLF+RR FN+EGI+C P+ D +S + L V D+ +LEQ++ Sbjct: 3 NYVIELLVRNHAGVMSQITGLFSRRNFNLEGIICGPVGDGGESRMILTVADNSKLEQILL 62 Query: 68 QIDKLEDVVKVQRNQSDP 85 Q++KL DV++V + P Sbjct: 63 QLEKLYDVLQVHKVDDHP 80 Lambda K H 0.324 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 40 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 88 Length adjustment: 9 Effective length of query: 87 Effective length of database: 79 Effective search space: 6873 Effective search space used: 6873 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 39 (19.6 bits)
Align candidate WP_027722599.1 H589_RS0113930 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.548.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.548.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.