Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_028309837.1 H566_RS0100150 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= reanno::SB2B:6938540 (460 letters) >NCBI__GCF_000482785.1:WP_028309837.1 Length = 452 Score = 209 bits (532), Expect = 2e-58 Identities = 133/434 (30%), Positives = 226/434 (52%), Gaps = 13/434 (2%) Query: 8 TISALQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVG 67 T+ A+D AH HPFT + I R EG ++ A G + LDA++ W G Sbjct: 2 TVPDWLALDRAHCWHPFTQARTAPV--PLAIVRGEGAWLHAADGRRYLDAVSSWWVNLHG 59 Query: 68 YGRKSIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEAND 127 + +IA+A Q +TLP + F THEPA RLA+++ + AP ++ VFF+ +GS A + Sbjct: 60 HAHPAIAEAIAEQARTLP-HTMFAGITHEPAARLAAELVARAPAPLSHVFFSDNGSTAIE 118 Query: 128 TNLRMVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIPGIVHIDQ 187 L++ +YW +G + ++ + YHG T + G + + + + + Sbjct: 119 VALKIACQYWINQGQ-KRHRFLAFEGGYHGDTFGAMAAGRSSGFYAPFEDWLFSVDFMPW 177 Query: 188 PYWFGEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPF-QGAGGVIIPPDSYWNE 246 P + + + E + L+A + G + +AAF+ EP QGA G+ + + Sbjct: 178 PQTWIDKPGLDDEEAAVLAR--LDAWLDRHGHE-LAAFVFEPLVQGASGMRMARAPFLRT 234 Query: 247 IKRILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSD 306 + + + I DEV++GFGRTG FAA+ +G PDL+ + KG+T G++PM + + Sbjct: 235 VCEKVRACGVPVIFDEVMTGFGRTGRMFAAEHIGFTPDLLCLCKGLTGGFLPMAVTLATP 294 Query: 307 RVADVLISDGGEFA--HGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQ 364 + D + DG + A HG T++ +P+ A AL ++R+ + E + ++ + Q RL Sbjct: 295 AIHDAFLGDGVDRALLHGHTFTANPLGCAAALASLRLFDSEDTMQRIASLEAMQAQ-RLA 353 Query: 365 TLSAHPLVGEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTM 424 L++HPLV R G + A +LV + +GS ++G REA I G++MR +GD + Sbjct: 354 ALASHPLVSRSRQWGTIAAFDLVPAGAASAGYGS--ASGRALREAMIARGVLMRPMGDAI 411 Query: 425 IISPPLCITRDEID 438 + PP CI+ ++D Sbjct: 412 YVLPPYCISVADLD 425 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 452 Length adjustment: 33 Effective length of query: 427 Effective length of database: 419 Effective search space: 178913 Effective search space used: 178913 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory