Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_028310175.1 H566_RS0102430 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000482785.1:WP_028310175.1 Length = 393 Score = 318 bits (815), Expect = 3e-91 Identities = 180/390 (46%), Positives = 246/390 (63%), Gaps = 14/390 (3%) Query: 6 IRDVDLKGKRVIMRVDFNVP-VKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP- 63 + D L GKRV +R D NVP DG + DDTRIRA++P IK+A + GA V++ SHLGRP Sbjct: 6 LTDQALSGKRVFIRADLNVPQADDGSITDDTRIRASVPGIKFAADAGAAVMVTSHLGRPT 65 Query: 64 KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123 +GEP PE SL PVA RLSELLGK V+ + V E+ GEV+LL+N R + GE Sbjct: 66 EGEPKPEDSLQPVADRLSELLGKPVRLIENWVDGGF-----EVASGEVVLLQNCRLNKGE 120 Query: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIP-SVAGFLMEKEIKFLSKVT 182 KN+ EL+K A+L DI+ NDAFGTAHRA A+ GIA+F P + AG L+ E+ L K Sbjct: 121 KKNNEELSKKMAALCDIYANDAFGTAHRAEATTHGIAKFAPIACAGPLLAAELDALGKAL 180 Query: 183 YNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDK 242 P +P V ++ G+KVS K+ ++ +L EK D++++GG + TFL A G +G S E+D Sbjct: 181 GAPARPLVAIVAGSKVSTKLTILKSLSEKVDQLIVGGGIANTFLLAEGAPIGKSLAEKDL 240 Query: 243 IDLAKELLEKAKEKGVEIVLPVDAVIAQKIEP-GVEKKVVRIDDGIPEGWMGLDIGPETI 301 + AK ++E K +G + LP D V A + P V + G E M LDIGP+T Sbjct: 241 VAEAKTIIEGMKARGASVPLPTDVVTATEFAPTAVATTKPVAETGADE--MILDIGPQTA 298 Query: 302 ELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVN 361 + ++ A T+VWNGP+GVFE D F GTK +A +IA + ++ GGGD+ AA+ Sbjct: 299 ASLGEIIAKAGTIVWNGPVGVFEFDQFGGGTKALAESIA---KSAGFSIAGGGDTLAAIG 355 Query: 362 KFGLEDKFSHVSTGGGASLEFLEGKELPGI 391 K+G+E ++STGGGA LEFLEG+ LP + Sbjct: 356 KYGIEKDVGYISTGGGAFLEFLEGRVLPAV 385 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 643 Number of extensions: 37 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 393 Length adjustment: 34 Effective length of query: 620 Effective length of database: 359 Effective search space: 222580 Effective search space used: 222580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory