Align glutamate-aspartate periplasmic-binding protein (characterized)
to candidate WP_028310946.1 H566_RS0107430 amino acid ABC transporter substrate-binding protein
Query= CharProtDB::CH_002441 (302 letters) >NCBI__GCF_000482785.1:WP_028310946.1 Length = 298 Score = 362 bits (930), Expect = e-105 Identities = 182/291 (62%), Positives = 223/291 (76%), Gaps = 5/291 (1%) Query: 10 ILALAL-SAGLAQADDAAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQD 68 +LAL L +AG A A D P TL +IA G I +GHRESS+PFSYYD+ Q+V+GYSQ+ Sbjct: 9 VLALGLVAAGSAVAQDVPP----TLKRIADTGTISLGHRESSIPFSYYDDNQQVIGYSQE 64 Query: 69 YSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSD 128 + +AVK +L P L +KL+P+TSQNRIPL+QNGT D ECGST+N VER +Q +F++ Sbjct: 65 IMLRVADAVKAELKLPALNIKLVPVTSQNRIPLVQNGTVDLECGSTSNTVERARQVSFTN 124 Query: 129 TIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMRIISAKDHG 188 +IFVVGTRL+TKK I DF +L K VVVT+GTTSE LL + NEE+ + M IISAKDHG Sbjct: 125 SIFVVGTRLMTKKTSGINDFPDLAGKNVVVTAGTTSERLLRRYNEEKGLKMNIISAKDHG 184 Query: 189 DSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRKDDPQFKKL 248 +SF TLE+GRAVAFMMDDALL GERAKAK+PD W +VG P SQEAYGCMLRKDD FKK+ Sbjct: 185 ESFLTLETGRAVAFMMDDALLYGERAKAKRPDEWTVVGTPMSQEAYGCMLRKDDAAFKKV 244 Query: 249 MDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDK 299 +D IA++ TSGEA K +DKWF PIPPK LN+ + SD ++ LFK PNDK Sbjct: 245 VDAAIAKIMTSGEAAKIYDKWFNKPIPPKGLNLAWPPSDAVQHLFKNPNDK 295 Lambda K H 0.314 0.130 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 298 Length adjustment: 27 Effective length of query: 275 Effective length of database: 271 Effective search space: 74525 Effective search space used: 74525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory