Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_028311054.1 H566_RS0108150 polyamine ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000482785.1:WP_028311054.1 Length = 365 Score = 236 bits (601), Expect = 9e-67 Identities = 135/326 (41%), Positives = 191/326 (58%), Gaps = 31/326 (9%) Query: 4 ITLRNVQKRF-GEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMI 62 +T R V+K + GE +++ LDLDIE GEF+ +GPSG GK+T L ++AG E + G+I + Sbjct: 8 VTFRKVRKTYDGEHLIVRDLDLDIERGEFLTLLGPSGSGKTTCLMMLAGFETPTAGEIRL 67 Query: 63 DGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKILN 122 G+ ++PP +R + +VFQ+YAL+PHMTV++NI FPL + K+ EI+++V A ++ Sbjct: 68 GGKVINKLPPWRRNIGVVFQNYALFPHMTVRENIRFPLAVRKLPAHEIDQKVKQALAMVK 127 Query: 123 LTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELHQS 182 L + +R P QLSGGQ+QR+A+ RA+V P L DEPL LD LR +M++EI LH S Sbjct: 128 LDAFGERYPQQLSGGQQQRIALARALVFSPELVLMDEPLGALDKQLREHMQMEIKHLHDS 187 Query: 183 LETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKMNLI 242 L T ++VTHDQ EA+TM+D+I V + GRI+Q+ LY PAN FVAGFIG + N + Sbjct: 188 LGITFVFVTHDQSEALTMSDRIAVFDKGRIQQLDRADALYERPANAFVAGFIG--ESNAL 245 Query: 243 EGPEAAKHGA------------------------TTIGIRPEH--IDLSREAGAWEGEVG 276 HGA T+ IRPE ID + EA Sbjct: 246 AATVEQHHGAECSLRLADGSLLRASVGDLGAENTATVSIRPERVLIDQAAEAAPNRFTAT 305 Query: 277 VSE--HLGSDTFLHVHVAGMPTLTVR 300 V E +LG L + +AG V+ Sbjct: 306 VKELVYLGDHLRLRLDLAGNGNFMVK 331 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 365 Length adjustment: 29 Effective length of query: 303 Effective length of database: 336 Effective search space: 101808 Effective search space used: 101808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory