Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_028312589.1 H566_RS0118410 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000482785.1:WP_028312589.1 Length = 264 Score = 342 bits (877), Expect = 5e-99 Identities = 174/259 (67%), Positives = 203/259 (78%), Gaps = 1/259 (0%) Query: 1 MAYENILVETR-GRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEK 59 +++EN+ VE G V ++ LNRPKALNAL+ L ELGAAL +ADD IGA+VVTGS K Sbjct: 6 LSHENLYVEFHDGGVAVIVLNRPKALNALSPDLTRELGAALDTLEADDTIGAVVVTGSAK 65 Query: 60 AFAAGADIGMMSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDI 119 AFAAGADI M ++YMDVY D+IT WE + + RKP IAAVAG+ALGGGCELAMMCD Sbjct: 66 AFAAGADIKAMKDWSYMDVYGADFITATWERLTTFRKPTIAAVAGYALGGGCELAMMCDF 125 Query: 120 IFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSR 179 I AADTA+FGQPEI +G +PGAGGTQRL R + K+KAM++ LT R MDAAEAERAGLVSR Sbjct: 126 ILAADTARFGQPEITIGTIPGAGGTQRLTRLIGKSKAMEMVLTGRMMDAAEAERAGLVSR 185 Query: 180 VIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATED 239 ++PA L+ EAI A IA P M+ KESVNRAYETTLAEG+ FERRLFHS FATED Sbjct: 186 ILPAEELLPEAIKTAQKIAGMSRPIAMLAKESVNRAYETTLAEGIRFERRLFHSTFATED 245 Query: 240 QKEGMAAFVEKRKPVFKHR 258 QKEGMAAFVEKR P F++R Sbjct: 246 QKEGMAAFVEKRAPAFRNR 264 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory