Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_028312608.1 H566_RS0118530 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000482785.1:WP_028312608.1 Length = 370 Score = 417 bits (1073), Expect = e-121 Identities = 221/371 (59%), Positives = 274/371 (73%), Gaps = 8/371 (2%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 M L +RNV K+Y + LK I++ I++GEFLILVGPSGCGKSTL++ IAGL+++T G Sbjct: 1 MGALSIRNVRKSYNN--VEILKGIDIEIEKGEFLILVGPSGCGKSTLLSMIAGLDSVTSG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I IGD+ V+ +SPKDRDIAMVFQSYALYP MSVRENI FGL+IRK+P+A D V RVA Sbjct: 59 EIRIGDRVVNDLSPKDRDIAMVFQSYALYPNMSVRENISFGLEIRKVPKATQDEIVNRVA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 K LQ+EHLL+RKP QLSGGQ+QRVAMGRA+AR P ++LFDEPLSNLDAKLRVEMRTE+KL Sbjct: 119 KTLQMEHLLDRKPSQLSGGQRQRVAMGRAIARDPALFLFDEPLSNLDAKLRVEMRTEIKL 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 +HQR+ TT VYVTHDQIEAMTLGDK+AVMK G +QQFGTP++IY+NPAN FVASF+GSP Sbjct: 179 LHQRMGTTIVYVTHDQIEAMTLGDKIAVMKAGELQQFGTPQQIYDNPANLFVASFMGSPS 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGL---EDRDVILGLRPEQIMLAAGE 297 MNF+P +++ G LD G++ + ++ L E R+V+ G+RPEQI Sbjct: 239 MNFIPAKVESLGGGYGVRLDGGKSSYVFPAVSADSRLKAWEGREVVFGIRPEQITHFQDG 298 Query: 298 GDSASSIRA---EVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKV 354 +R V + EPTGPDTLV V +N V CR+ P A Q GET+ L FD SK Sbjct: 299 VPLPEHVRTAELPVSLIEPTGPDTLVLVPINGKGVTCRVHPAHARQPGETMALNFDLSKA 358 Query: 355 LLFDANTGERL 365 + FD T +R+ Sbjct: 359 VFFDPATEQRI 369 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 370 Length adjustment: 30 Effective length of query: 356 Effective length of database: 340 Effective search space: 121040 Effective search space used: 121040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory