Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_028312615.1 H566_RS0118565 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_000482785.1:WP_028312615.1 Length = 322 Score = 261 bits (667), Expect = 2e-74 Identities = 145/310 (46%), Positives = 187/310 (60%), Gaps = 2/310 (0%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKV-EVKDGCIAIA 64 LVGD+GGTNAR AL I+ A+T + I YL E + + I IA Sbjct: 11 LVGDIGGTNARFALIAAPGAPITDARTLPCASHAGPREAIDAYLAEGGLPRPRAAAIGIA 70 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 PITGD V MTN+ W FSI ++++ LG L INDFTA+++A+P L + L+Q GG Sbjct: 71 NPITGDAVRMTNNPWRFSIEQVRRELGLDRLLFINDFTALALALPTLAADELVQIGGKAA 130 Query: 125 VEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIG-H 183 V GK +A+ GAGTGLG++ LV +RWV L GEGGHV A EA ++E LR G H Sbjct: 131 VPGKALALLGAGTGLGISGLVPHGERWVPLEGEGGHVTLAAFDAREARVVEALRRRHGGH 190 Query: 184 VSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGR 243 VSAERVLSGPGL L+ A+ + D + L IT RALA C C + +FC ++G Sbjct: 191 VSAERVLSGPGLEALHAALAEVDELPADGLDAAAITGRALAGGCDRCAATVDMFCAMLGT 250 Query: 244 FGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDN 303 +LAL LG GGV+I GG+VPR E F +S FRA FE+KGRF +Y+ IPV++I D Sbjct: 251 VAADLALTLGARGGVYIGGGVVPRLGERFASSPFRARFEEKGRFGDYLAGIPVFVIHADY 310 Query: 304 PGLLGSGAHL 313 P L G+ L Sbjct: 311 PALRGAARAL 320 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 322 Length adjustment: 28 Effective length of query: 293 Effective length of database: 294 Effective search space: 86142 Effective search space used: 86142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory