Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_028312615.1 H566_RS0118565 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_000482785.1:WP_028312615.1 Length = 322 Score = 261 bits (667), Expect = 2e-74 Identities = 145/310 (46%), Positives = 187/310 (60%), Gaps = 2/310 (0%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKV-EVKDGCIAIA 64 LVGD+GGTNAR AL I+ A+T + I YL E + + I IA Sbjct: 11 LVGDIGGTNARFALIAAPGAPITDARTLPCASHAGPREAIDAYLAEGGLPRPRAAAIGIA 70 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 PITGD V MTN+ W FSI ++++ LG L INDFTA+++A+P L + L+Q GG Sbjct: 71 NPITGDAVRMTNNPWRFSIEQVRRELGLDRLLFINDFTALALALPTLAADELVQIGGKAA 130 Query: 125 VEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIG-H 183 V GK +A+ GAGTGLG++ LV +RWV L GEGGHV A EA ++E LR G H Sbjct: 131 VPGKALALLGAGTGLGISGLVPHGERWVPLEGEGGHVTLAAFDAREARVVEALRRRHGGH 190 Query: 184 VSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGR 243 VSAERVLSGPGL L+ A+ + D + L IT RALA C C + +FC ++G Sbjct: 191 VSAERVLSGPGLEALHAALAEVDELPADGLDAAAITGRALAGGCDRCAATVDMFCAMLGT 250 Query: 244 FGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDN 303 +LAL LG GGV+I GG+VPR E F +S FRA FE+KGRF +Y+ IPV++I D Sbjct: 251 VAADLALTLGARGGVYIGGGVVPRLGERFASSPFRARFEEKGRFGDYLAGIPVFVIHADY 310 Query: 304 PGLLGSGAHL 313 P L G+ L Sbjct: 311 PALRGAARAL 320 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 322 Length adjustment: 28 Effective length of query: 293 Effective length of database: 294 Effective search space: 86142 Effective search space used: 86142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_028312615.1 H566_RS0118565 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.14374.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-96 307.0 0.0 8.6e-96 306.9 0.0 1.0 1 lcl|NCBI__GCF_000482785.1:WP_028312615.1 H566_RS0118565 glucokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000482785.1:WP_028312615.1 H566_RS0118565 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 306.9 0.0 8.6e-96 8.6e-96 1 315 [] 11 317 .. 11 317 .. 0.97 Alignments for each domain: == domain 1 score: 306.9 bits; conditional E-value: 8.6e-96 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiigdf 69 lvgdiGGtnar+al+ i ++t+ + + +++ yl e l p +++ ia Pi+gd lcl|NCBI__GCF_000482785.1:WP_028312615.1 11 LVGDIGGTNARFALIAAPGAPITDARTLPCASHAGPREAIDAYLAEG--GLPRPRAAAIGIANPITGDA 77 89************8887888***********************987..578899************** PP TIGR00749 70 vrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtGlG 138 vr+tn+ W +sie++++el+l +l indf+a a+a+++l ++l+q+gg +++++a a+lGaGtGlG lcl|NCBI__GCF_000482785.1:WP_028312615.1 78 VRMTNNPWRFSIEQVRRELGLDRLLFINDFTALALALPTLAADELVQIGGKAAVPGKALALLGAGTGLG 146 ********************************************************************* PP TIGR00749 139 vatliqqsdgrykvlageGghvdfaPrseleillleylrkky.grvsaervlsGsGlvliyealskrkg 206 ++ l++ +r++ l geGghv +a ++ e+ ++e lr++ g+vsaervlsG+Gl ++ al + + lcl|NCBI__GCF_000482785.1:WP_028312615.1 147 ISGLVP-HGERWVPLEGEGGHVTLAAFDAREARVVEALRRRHgGHVSAERVLSGPGLEALHAALAEVD- 213 ******.5679*****************************9999*************99999987665. PP TIGR00749 207 erevsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfie 275 l+ + l i+ +al+g + + ++++f+++lG++a++lal+lgarGGvy+ GG+vPr+ e lcl|NCBI__GCF_000482785.1:WP_028312615.1 214 -----ELPADGLDAAAITGRALAGGCDRCAATVDMFCAMLGTVAADLALTLGARGGVYIGGGVVPRLGE 277 .....99*99*********************************************************** PP TIGR00749 276 llkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 + +s+fra+fe+kGr++++la iPv v+ + + l Ga+ lcl|NCBI__GCF_000482785.1:WP_028312615.1 278 RFASSPFRARFEEKGRFGDYLAGIPVFVIHADYPALRGAA 317 **************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (322 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.70 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory