Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_028312699.1 H566_RS0119110 carbohydrate kinase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3036 (314 letters) >NCBI__GCF_000482785.1:WP_028312699.1 Length = 309 Score = 276 bits (706), Expect = 5e-79 Identities = 147/311 (47%), Positives = 197/311 (63%), Gaps = 4/311 (1%) Query: 1 MYLVCGEALFDFFSENDASGLASKVNFKAIAGGSPFNVAVGLRRLGVDAALLAGLSTDYL 60 M+LVCGEALFD F + A + ++ +A GGSPFNVA+GL RLG LLAG++ D+L Sbjct: 1 MFLVCGEALFDVFVQPGAKRV---MHLEAHPGGSPFNVAIGLARLGQPVGLLAGIADDFL 57 Query: 61 GRRLLQVLQDEGVCLDYLLEFAAPTTLAMVAVGANGSPQYSFRGEGCADRQLQAEHLPTL 120 GRRL QVL++EGV L+ AP+TLA + A+G P Y+F G G ADR L + LP L Sbjct: 58 GRRLAQVLEEEGVSTASLVPLDAPSTLAFIQTAADGQPVYAFYGNGAADRLLTPDRLPPL 117 Query: 121 GPEVRGLHIGSFSLVVQPIADTLLALVRRESGKRLISLDPNVRLNPEPDIDLWRKRVATL 180 P VR +H+GS++ VV+P+AD AL RE G+ +IS DPNVRLN EP + WR +V L Sbjct: 118 DPAVRAIHLGSYASVVRPVADAYAALAARERGRCVISYDPNVRLNVEPSKEAWRAKVDEL 177 Query: 181 VELADLIKVSDEDLHLLYPDQDPAQVIEGWLQHRCQLVFLTRGGEGATVFSRAHGSWSAP 240 +A ++K+SDED+ LLY D +PA + WL +LV +TRG EGA ++ + P Sbjct: 178 TAIAHVVKISDEDIGLLYGDIEPAALALQWLARGVKLVIVTRGAEGAAAWTEGVHA-EVP 236 Query: 241 ACSVKIADTVGAGDTFQAALITWLTEQQLDSVEGVKQLGREQIDRMLKFAVRAAALTCSK 300 V + DTVGAGDTFQAA + WL Q + E + +L + +L A RAAA+TCS+ Sbjct: 237 GVKVDVIDTVGAGDTFQAATLDWLARQGRLTPEAIGRLDAPALAALLGHAARAAAITCSR 296 Query: 301 TGPDLPYRKQL 311 G DL +L Sbjct: 297 RGADLARASEL 307 Lambda K H 0.321 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 309 Length adjustment: 27 Effective length of query: 287 Effective length of database: 282 Effective search space: 80934 Effective search space used: 80934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory