Align Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized)
to candidate WP_028312762.1 H566_RS0119530 amino acid ABC transporter permease
Query= TCDB::Q9I404 (222 letters) >NCBI__GCF_000482785.1:WP_028312762.1 Length = 224 Score = 86.7 bits (213), Expect = 3e-22 Identities = 60/204 (29%), Positives = 100/204 (49%), Gaps = 7/204 (3%) Query: 3 DFSGIVPALPSLWEGMLMTLKLMVLGVLGGVALGTVLALMRLSHSKLLSNIAGFYVNYFR 62 +F I LP L +G+ +T L ++G GVALG A +R + L +A YV FR Sbjct: 6 EFGVIADYLPVLGKGLALTGLLTLVGATLGVALGIGCAWVRTQGPRWLRPVAAGYVELFR 65 Query: 63 SIPLLLVITWFYFAVPFILRWITGEDTPVGAFTSCLVAFMMFEAAYYCEIVRAGIQAIPK 122 + P L+ + + +F +P +G F++ +A ++ AY EI+RAGI+A P+ Sbjct: 66 NTPFLVQLFFIFFGLP-------AAGVQLGEFSAAALAMVVNLGAYSGEIIRAGIEATPR 118 Query: 123 GQMGAAQALGMTYGQTMRLVILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLMDFLNSAR 182 GQ A +L MT Q R V+L A +++ P L Q +I+ +++ + + +A Sbjct: 119 GQWEAGASLAMTRLQIFRHVVLVPALQRIWPALSSQIVIVMLGSAVCSQIAAEELTFAAN 178 Query: 183 SRGDIIGQANEFLIFAGLVYFVVS 206 +A E I +Y +S Sbjct: 179 FIQSRSFRAFEVYIVVTGIYLALS 202 Score = 26.2 bits (56), Expect = 5e-04 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 11/77 (14%) Query: 7 IVPALPSLWEGMLMTLKLMVLGVLGGVALGTVLALMRLSHSKLLSNIAGFYVNY-FRSIP 65 +VPAL +W + + +++LG A+ + +A L+ + A F + FR+ Sbjct: 140 LVPALQRIWPALSSQIVIVMLGS----AVCSQIAAEELTFA------ANFIQSRSFRAFE 189 Query: 66 LLLVITWFYFAVPFILR 82 + +V+T Y A+ +LR Sbjct: 190 VYIVVTGIYLALSVLLR 206 Lambda K H 0.331 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 222 Length of database: 224 Length adjustment: 22 Effective length of query: 200 Effective length of database: 202 Effective search space: 40400 Effective search space used: 40400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory