Align Putative UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_028313395.1 G491_RS0102035 KR domain-containing protein
Query= curated2:Q57664 (305 letters) >NCBI__GCF_000429905.1:WP_028313395.1 Length = 306 Score = 197 bits (501), Expect = 3e-55 Identities = 127/304 (41%), Positives = 179/304 (58%), Gaps = 14/304 (4%) Query: 3 LVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNKNNINP---KAEFVNADIRDKDLDEK 59 LVTGG GFIGSHI + L E V ILD+L++G + NI K EF+ DIRD + K Sbjct: 4 LVTGGCGFIGSHISEVLAEKGEKVRILDDLSSGYEANIADFADKVEFIKGDIRDPEAVAK 63 Query: 60 INFKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGAV 119 K V+ V H A ++ +SVE P+ DINV GT+NIL R + ++VFASS AV Sbjct: 64 A-MKGVDGVFHLAGMVSAFDSVERPLVCHDINVTGTLNILTAARDAGVKRVVFASSC-AV 121 Query: 120 YGEPNYLPVDENHPINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVYGERQDPKG 179 YG P E P SPY SK E Y++++ LYG++ LR+ NV+G RQDP Sbjct: 122 YGNNPESPKVEAMTRAPASPYAASKAASELYMRVFAELYGVQTVCLRFFNVFGPRQDPSS 181 Query: 180 E-AGVISIFIDKMLKNQSPIIFGDGNQTRDFVYVGDVAKANLMALN----WKNEIVNIGT 234 + +GVIS F++ + + I+GDG QTRDF++V DV +ANL+A+ E VN+GT Sbjct: 182 QYSGVISRFVNDTAEGYA-CIYGDGLQTRDFIFVRDVVRANLLAMTSNKAGAGEAVNVGT 240 Query: 235 GKETSVNELFDIIKHEIGFRG-EAIYDKPREGEVYRIYLDIKKA-ESLGWKPEIDLKEGI 292 G E S+ +L D ++ E+G R E ++ R G+V DI KA E LG++P ++ G+ Sbjct: 241 GVEISLLDLLDYMR-ELGDREFEVMFKDARAGDVRHSRADISKAQELLGFEPAYTIRNGL 299 Query: 293 KRVV 296 ++ Sbjct: 300 AELL 303 Lambda K H 0.317 0.140 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 11 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 306 Length adjustment: 27 Effective length of query: 278 Effective length of database: 279 Effective search space: 77562 Effective search space used: 77562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory