Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate WP_028313899.1 G491_RS0105795 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >NCBI__GCF_000429905.1:WP_028313899.1 Length = 357 Score = 178 bits (452), Expect = 2e-49 Identities = 107/322 (33%), Positives = 171/322 (53%), Gaps = 35/322 (10%) Query: 96 LALIVGALVWPFFGSRGAVDIATLILIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSY 155 LAL+VG L P + T I IY + G+GL ++ G G + +G+ F A+G+Y+ Sbjct: 26 LALVVGCLFLPKILDEYMLSQLTFICIYAVAGVGLMLLTGFTGQISMGHAAFLAIGSYTS 85 Query: 156 ALLSHYFGLSFWICLPIAGMMAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLT 215 A+L+ G+ F + LP +G+ AA G ++G P+L L G YLAI T+G II L Sbjct: 86 AVLTAK-GVPFLLALPASGVTAALVGIVIGRPILHLTGLYLAIATMGAAFIIEEILVRWE 144 Query: 216 DITGGPNGISNIEKPTFFGLTFERKAAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALA 275 IT G G+ ++ P FG F+ ++ F YL +L + + Sbjct: 145 SITNGNMGMM-VDTPVIFGFNFD---------------------TEIRFFYL-SLAVLII 181 Query: 276 ALFVINRLLRMPIGRAWEALREDEIACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQ 335 L + +LR P GRA+ A+R+ EIA A+G+N K +F + A F G AGS +A + Sbjct: 182 VLLLAKNILRSPTGRAFIAIRDSEIAAEAMGINLPSFKTQSFAVSAFFTGIAGSLYAHKI 241 Query: 336 GLVTPESFTFIESAIILAIVVLGGMGSQLGVILAAIVMILLPEMMREFSEY--------- 386 + PES+T ++S +LAIV++GG+GS G + +I I LP+++ +Y Sbjct: 242 FFINPESYTIMQSIELLAIVIIGGLGSLHGAVYGSIFFIFLPQLIIISKDYLPSFVQDQT 301 Query: 387 --RMLMFGALMVLMMIWRPQGL 406 + +FG L++L+M++ P G+ Sbjct: 302 GLQPALFGLLIILVMLFEPMGI 323 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 357 Length adjustment: 30 Effective length of query: 388 Effective length of database: 327 Effective search space: 126876 Effective search space used: 126876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory