Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_028314019.1 G491_RS0106655 acetyl-CoA C-acetyltransferase
Query= BRENDA::P45359 (392 letters) >NCBI__GCF_000429905.1:WP_028314019.1 Length = 428 Score = 402 bits (1033), Expect = e-116 Identities = 211/429 (49%), Positives = 283/429 (65%), Gaps = 39/429 (9%) Query: 1 MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKP--------------- 45 MKE VI S RTAIGS+G LK VP + LG+T +KE +K+ ++P Sbjct: 1 MKEAVIVSGARTAIGSFGGVLKSVPVIQLGSTVMKETLKRVNLRPVVSEAMLSAAPDALK 60 Query: 46 --------------ED------VNEVILGNVLQAGLGQNPARQASFKAGLPVEIPAMTIN 85 +D ++EVI+GNVL +G GQNPARQA +AG+ E PA T+N Sbjct: 61 DQGVIELEEKGMDWDDSAQPVAIDEVIMGNVLTSGQGQNPARQAMVQAGICKETPAFTVN 120 Query: 86 KVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSRAPYLANNARWGYRM---GNAKFVDE 142 KVC SGL+ ++L A I G ADVI+AGG E+MS P ARWGYRM G + D Sbjct: 121 KVCASGLKAIALGAASIMTGQADVILAGGQESMSNVPMALPLARWGYRMAISGKGEIDDL 180 Query: 143 MITDGLWDAFNDYHMGITAENIAERWNISREEQDEFALASQKKAEEAIKSGQFKDEIVPV 202 M+ DGL++ F YHMG+TAENIA ++ I+REEQD + S +A +AI G FKDEIVPV Sbjct: 181 MVLDGLYEIFYGYHMGVTAENIASKYGITREEQDALGVLSHNRARKAITEGLFKDEIVPV 240 Query: 203 VIKGRKGETVVDTDEHPRFGSTIEGLAKLKPAFKKDGTVTAGNASGLNDCAAVLVIMSAE 262 R+ E VVDTDE P +++E +AKL+PAF KDGTVTAGNASG+ND AA +++MSAE Sbjct: 241 SFMERRKEVVVDTDERP-MDTSMEKMAKLRPAFIKDGTVTAGNASGINDGAASVLLMSAE 299 Query: 263 KAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAFAAQ 322 KA+ELG++PLAKI ++ SAG+DPA MG GP A + ++ G ++D+L ++E NEAFA+Q Sbjct: 300 KAQELGLEPLAKIKAFASAGMDPAYMGLGPIPAVRKVLKATGMSIDDLQMLEVNEAFASQ 359 Query: 323 SLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILVTLVHAMQKRDAKKGLATLCIGGG 382 ++A ++L D K N G I+LGHPIG +GAR +VT +H M+++ GL T+CIGGG Sbjct: 360 AIACLRELGIDTEKPNELGSGISLGHPIGCTGARQMVTAIHHMERKGYNTGLITMCIGGG 419 Query: 383 QGTAILLEK 391 G A+++EK Sbjct: 420 MGMAMIIEK 428 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 428 Length adjustment: 31 Effective length of query: 361 Effective length of database: 397 Effective search space: 143317 Effective search space used: 143317 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_028314019.1 G491_RS0106655 (acetyl-CoA C-acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.3798813.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-139 450.5 5.8 1.8e-132 427.9 3.8 2.0 2 NCBI__GCF_000429905.1:WP_028314019.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000429905.1:WP_028314019.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.9 0.0 1.9e-09 1.9e-09 1 44 [. 6 48 .. 6 65 .. 0.88 2 ! 427.9 3.8 1.8e-132 1.8e-132 39 385 .] 79 427 .. 71 427 .. 0.94 Alignments for each domain: == domain 1 score: 22.9 bits; conditional E-value: 1.9e-09 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekid 44 iv+++Rt+ig++gg+lk+++ +L+++v+ke l+r++l p + NCBI__GCF_000429905.1:WP_028314019.1 6 IVSGARTAIGSFGGVLKSVPVIQLGSTVMKETLKRVNLRP-VVS 48 8************************************998.444 PP == domain 2 score: 427.9 bits; conditional E-value: 1.8e-132 TIGR01930 39 dpekidevilGnvlqageqaniaReaalaaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvE 111 +p +idevi+Gnvl++g+++n+aR+a+++ag+ +++pa+tvn+vCaSgl+A+al+a++i++G+adv++aGG E NCBI__GCF_000429905.1:WP_028314019.1 79 QPVAIDEVIMGNVLTSGQGQNPARQAMVQAGICKETPAFTVNKVCASGLKAIALGAASIMTGQADVILAGGQE 151 6889********************************************************************* PP TIGR01930 112 smSrvpillkaslr.reslklgkakledqllkdl...vktklsmgetAenlakkygisReeqDeyalrShqka 180 smS+vp+ l+ +++ ++++ gk + +d ++ d+ +++mg+tAen+a kygi+ReeqD++ + Sh++a NCBI__GCF_000429905.1:WP_028314019.1 152 SMSNVPMALPLARWgYRMAISGKGEIDDLMVLDGlyeIFYGYHMGVTAENIASKYGITREEQDALGVLSHNRA 224 **********985434444445666677666666999889********************************* PP TIGR01930 181 akAieegkfkdeivpvevkgk..kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaall 251 kAi eg fkdeivpv++ ++ ++vv++De + +t++ek+akL+paf + +g tvtAgN+s++nDGAa +l NCBI__GCF_000429905.1:WP_028314019.1 225 RKAITEGLFKDEIVPVSFMERrkEVVVDTDERPM-DTSMEKMAKLRPAFIK-DG-TVTAGNASGINDGAASVL 294 *******************999777777777766.9*************95.9*.6***************** PP TIGR01930 252 lmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekel 324 lms e+a+elgl+pla+i ++a ag+dp++mglgp+pA++k+Lk +g+si+d+++ E+nEAFA+q++a+ +el NCBI__GCF_000429905.1:WP_028314019.1 295 LMSAEKAQELGLEPLAKIKAFASAGMDPAYMGLGPIPAVRKVLKATGMSIDDLQMLEVNEAFASQAIACLREL 367 ************************************************************************* PP TIGR01930 325 gsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 g +d+ek N G+ i+lGHP+G++Gar ++t +++++++g + Gl+t+C+ggG+G+A+i+e NCBI__GCF_000429905.1:WP_028314019.1 368 G-IDTEKPNELGSGISLGHPIGCTGARQMVTAIHHMERKGYNTGLITMCIGGGMGMAMIIE 427 *.88*******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (428 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 30.20 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory