Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_028314742.1 G491_RS0111750 NAD(P)-dependent oxidoreductase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >NCBI__GCF_000429905.1:WP_028314742.1 Length = 265 Score = 147 bits (370), Expect = 3e-40 Identities = 87/253 (34%), Positives = 133/253 (52%), Gaps = 2/253 (0%) Query: 16 GERLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQGADVVAI 75 G RL+ K ++TGAA GIG A FA A L+++D+ E + VAA ++GA VV Sbjct: 4 GPRLQGKTAIITGAASGIGAATATLFAEHGASLVLADVVEEALAAVAAQAEEKGAKVVYK 63 Query: 76 KADVSRQQDLHAMARLAIDLHGRIDVLVNCAGV-NVFRDPLEMTEEDWRRCFAIDLDGAW 134 DVS ++ + A+ LA+D +G+IDVL N AG+ F D +E+W+R A++L G Sbjct: 64 TTDVSDEEQVKALVDLALDTYGQIDVLCNNAGITGDFTDMNSEDQENWKRVLAVNLIGPV 123 Query: 135 YGCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVR 194 K P M ++G GSI+N AS G Y +K L+ T+ + VR Sbjct: 124 LLTKYAAPYMKDRGCGSIVNTASVAGIRAGAGSNAYSASKAALINFTKTAACDLGSFNVR 183 Query: 195 VNAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPF 254 VNA+ PG IET + ++ +A + + +R G P E+A +FLA DE+ + Sbjct: 184 VNAVCPGLIETGMTKMVFD-YARDAGKEAKLGSRCEMKRYGLPHEIAFAILFLACDESSY 242 Query: 255 INASCITIDGGRS 267 + + +DGG + Sbjct: 243 VTGQHLAVDGGNT 255 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory