Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_028315368.1 G491_RS0116425 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000429905.1:WP_028315368.1 Length = 256 Score = 245 bits (625), Expect = 8e-70 Identities = 128/249 (51%), Positives = 166/249 (66%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +LK+ G+ K FGGL A+ +V + +G ++GLIGPNGAGKTT FN+ITG Y PD G Sbjct: 3 LLKLDGVVKTFGGLTAVDEVSFEVPKGSIFGLIGPNGAGKTTVFNLITGNYKPDRGAVVF 62 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ H++ + G+ARTFQ IRLF EM+ LENV+ G H R SG A+FR + Sbjct: 63 NGENITGRITHKIVELGVARTFQTIRLFQEMSVLENVLAGCHCRMTSGPISAMFRLPKAR 122 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 EE +A L + G+ A+ A+ LSYG+QR LEIARALATDPQL+ LDEPA GM Sbjct: 123 REEKKTLGKALAELRFTGLEAQAENLAKNLSYGNQRLLEIARALATDPQLLILDEPAGGM 182 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 N E L ELI +I+ T+LLIEHD+ LVM C+ + V++YGK+IAEG P V+K+ Sbjct: 183 NEQETAALVELIFQIQQRGITVLLIEHDMSLVMKACEYLVVIEYGKKIAEGTPDVVKKDP 242 Query: 249 KVIEAYLGT 257 KVIEAYLG+ Sbjct: 243 KVIEAYLGS 251 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory