Align Enoyl-CoA hydratase ACTT3; ACT-toxin biosynthesis protein 3; EC 4.2.1.17 (characterized)
to candidate WP_028315727.1 G491_RS0119220 enoyl-CoA hydratase
Query= SwissProt::Q589W8 (296 letters) >NCBI__GCF_000429905.1:WP_028315727.1 Length = 286 Score = 182 bits (462), Expect = 8e-51 Identities = 105/258 (40%), Positives = 160/258 (62%), Gaps = 14/258 (5%) Query: 23 DGIAVIVLARSQSRNALTLPMLTDMVQLLSAMDADDSVKCIVFTGEGQFFCSGVDL-TEG 81 DGI I L R NA T+ M ++++ L D DD V+ I+FTG G+ FC+G++L EG Sbjct: 12 DGILTITLNRPDRLNAFTITMKSEIIDALDRADNDDDVRAIIFTGAGRAFCAGMELGAEG 71 Query: 82 --FGEIGKTRDTH-----RDAGGKLALAIHNCRKPTIAAINGTAVGVGITMTLPMSIRIA 134 FG ++ + RD+GG+++L I++C+KP IAAING AVGVGITMTL M R+A Sbjct: 72 NIFGYEIPQKEPYNIEEIRDSGGEVSLRIYDCKKPVIAAINGPAVGVGITMTLGMDFRLA 131 Query: 135 AESAKISFPFVRRGIVADAASSFYLPRLIGYGRALHLFTTGALYPAESGLLHGLFSETVN 194 +E AK+ F F +RG+ +A SS++LPR++G +AL +G ++PA+ G GL +++ Sbjct: 132 SEKAKLGFVFSQRGLCIEACSSWFLPRIVGVSQALEWAYSGEVFPAQEGKDGGLI-RSLH 190 Query: 195 PASSTLPRALEVARDIAVNASQVGVYLTRDLIYRSLRS--PEQAHLLESATLYTRYQSQ- 251 LP A +A+ + + + L R L+Y+ + + P AH ++S ++Y Y S+ Sbjct: 191 APEDLLPAAKALAKKFTEKTAPISIALNRQLMYKMMGASHPMDAHNMDSRSIY--YASET 248 Query: 252 DFEEGVKSFLEKRRPRFQ 269 D +EGV SFLEKR P F+ Sbjct: 249 DGKEGVMSFLEKRAPEFK 266 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 286 Length adjustment: 26 Effective length of query: 270 Effective length of database: 260 Effective search space: 70200 Effective search space used: 70200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory