Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_028316288.1 G491_RS0123515 3-hydroxybutyryl-CoA dehydrogenase
Query= BRENDA::C4IEM5 (282 letters) >NCBI__GCF_000429905.1:WP_028316288.1 Length = 386 Score = 229 bits (584), Expect = 7e-65 Identities = 126/283 (44%), Positives = 181/283 (63%), Gaps = 4/283 (1%) Query: 1 MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEA 60 +KK+ V+G+G MG GIVQ A G V ++D+K+EF+DRG+ I +SL LV KEKI+ Sbjct: 6 VKKIAVIGSGDMGHGIVQVAAMAGYNVAMKDVKQEFLDRGMGKIVESLDILVGKEKISAQ 65 Query: 61 DKEEILSRISGTTDMKLA-ADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSL 119 DKE++++RIS TTD A +D +V+EA E M +KK +F+E+ + ILA+NTS++ Sbjct: 66 DKEDVMARISATTDTAEAVSDAQIVIEAVPEIMDLKKSVFSEVSASAPGDAILATNTSTM 125 Query: 120 SITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEV 179 SITE++ A + G+HFFNP MKLVE+I+GA TS T D + + +E++ K PV V Sbjct: 126 SITEISKAVNNPARFAGLHFFNPVNRMKLVEIIKGAETSDATADVLVKFTEAVKKIPVVV 185 Query: 180 -AEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVC 238 ++PGF+VNRI P + IL EG K +++D AMK+ P GP L D +GLDV Sbjct: 186 LKDSPGFIVNRINAPNQAMLSAILDEGKIKPDELDTAMKM-VGMPQGPYELADFVGLDVF 244 Query: 239 LAIMDVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDYS 281 + + Y ET +++ L V AG LG+KTG+G YD+S Sbjct: 245 VHTLK-YYAETLSPEFQPGKYLTAKVEAGDLGKKTGQGIYDWS 286 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 386 Length adjustment: 28 Effective length of query: 254 Effective length of database: 358 Effective search space: 90932 Effective search space used: 90932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory