Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_028320746.1 H567_RS0106215 acyl-CoA dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_1146 (375 letters) >NCBI__GCF_000422285.1:WP_028320746.1 Length = 380 Score = 332 bits (852), Expect = 8e-96 Identities = 176/375 (46%), Positives = 239/375 (63%), Gaps = 6/375 (1%) Query: 4 TEEQTQIRDMARQFAEERLKPFAAEWDREHRFPREAIDEMAELGFFGMLVPEQWGGCDTG 63 TE+ +R R F E L+P A + D+E FP E +++M LG+FG+ VP + GG Sbjct: 6 TEKGRAVRRSVRGFCERELRPIARQIDQEASFPWEVVEKMGRLGYFGIQVPHELGGAGMD 65 Query: 64 YLAYAMTLEEIA---AGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGA 120 + Y + +EEI+ AG G C T VHNSV P++ FG+ EQK K++ PLA G +GA Sbjct: 66 AVCYCVVIEEISRVCAGLGLCVT---VHNSVAVYPLMAFGSGEQKRKWVPPLARGQKIGA 122 Query: 121 FALTEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGIS 180 F LTEP AGSDA+ ++ A GDHY++N K F+T+G A V ++FA TDP AG++GIS Sbjct: 123 FCLTEPNAGSDAAGIEATAIRNGDHYIVNANKVFVTNGGVADVCLIFARTDPKAGRKGIS 182 Query: 181 AFIVPTDSPGYSVARVEDKLGQHASDTCQILFEDLKVPVGNRLGEEGEGYKIALANLEGG 240 + +PG+ V +ED G A+ I D VP N LG EG G KI LA L+ G Sbjct: 183 VVVAERGTPGFVVGDLEDLCGVRANPVSSIRLYDCPVPAENLLGREGMGLKIGLAALDAG 242 Query: 241 RVGIAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYA 300 R+GIAAQAVG+++AA E YAR+R FG PI +HQAV LADMA ++ +R +V+ + Sbjct: 243 RMGIAAQAVGISQAALEEGVLYARQRRQFGVPIGQHQAVGGMLADMAARVEASRLLVYRS 302 Query: 301 AALRDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIY 360 A LRD G+ A+MAKL+A+E A +V ALQ GGYGY +P+ER YRD RV +IY Sbjct: 303 ARLRDQGKSFGQAAAMAKLYAAEAASEVTDKALQIHGGYGYSKAYPVERYYRDARVTRIY 362 Query: 361 EGTSDIQRMVISRNL 375 EGTS++ R+V++R L Sbjct: 363 EGTSEVHRLVVARGL 377 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 26 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory