Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_028320915.1 H567_RS0107410 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_000422285.1:WP_028320915.1 Length = 291 Score = 161 bits (407), Expect = 2e-44 Identities = 103/294 (35%), Positives = 154/294 (52%), Gaps = 16/294 (5%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQ LV G+ G Y LI +G +++ G++G+IN AHG++ M+ YI F+ T L GLD Sbjct: 4 FLQTLVAGILKGGLYGLIGMGMSLIMGVMGIINLAHGQLMMVAMYITFVCFTYL---GLD 60 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIP---LISAIGMSIFLQNAVML 123 +++ A ++ G I+R A PL L+P ++ +G+ + L Sbjct: 61 PYAALLITMPALFLL-----GALIQRYALNPLMEVESLLPENQVLMTVGIGMVLTEIARF 115 Query: 124 SQDSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRAC 183 S K++ T + F + G+ S F + L + F+ ++ LGRA Sbjct: 116 IFSSDYKSVQTAYSSSSFF----LRGISFSVALTAAFFIALLFTGFMFWFLLKTDLGRAI 171 Query: 184 RACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFT 243 RA A+D L+G+++ I LTF IG+AL A A LL M + P IG KAF Sbjct: 172 RATAQDKDAALLMGVDAKRITILTFGIGSALVAAAGTLL-MPIYYLFPDIGSPFTRKAFV 230 Query: 244 AAVLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTG 297 +LGG+GS GA+ GGL LG+AEAFGA G + D++ + ILVLLF P+G Sbjct: 231 ITILGGLGSTVGAIFGGLTLGLAEAFGATYIGMAFDDMIGLLIFILVLLFLPSG 284 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 291 Length adjustment: 27 Effective length of query: 280 Effective length of database: 264 Effective search space: 73920 Effective search space used: 73920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory