Align phosphomannomutase (EC 5.4.2.8) (characterized)
to candidate WP_028487539.1 Q394_RS0100435 phosphomannomutase/phosphoglucomutase
Query= BRENDA::P26276 (463 letters) >NCBI__GCF_000621325.1:WP_028487539.1 Length = 466 Score = 405 bits (1041), Expect = e-117 Identities = 211/455 (46%), Positives = 285/455 (62%), Gaps = 6/455 (1%) Query: 12 SIFRAYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQG 71 S+FRAYD+RGV D LT + IG+AIGS+ G V +GRDGRLS P L + + +G Sbjct: 11 SLFRAYDVRGVYADNLTEHSVRLIGQAIGSQLRDMGTQSVVLGRDGRLSSPTLAQAVTEG 70 Query: 72 LVDCGCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQI 131 L+ GC V+D+GM+PTPVLY+A GVM+TGSHNPP+ NG KIV+ GE NEQI Sbjct: 71 LLQAGCHVTDLGMLPTPVLYFAVQSGLAPHGVMITGSHNPPNENGIKIVINGECQYNEQI 130 Query: 132 QALRERIEKNDL--ASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAP 189 Q L ERI + +L G + ILP Y + + I + + +++ VDCGNG ++A Sbjct: 131 QNLYERIVRGELWHQPQAGKLHTATILPAYQQAVCQQIHLQRRLRIGVDCGNGATALLAE 190 Query: 190 QLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVG 249 QL +GC V PL+C+VDGNFPNH PDP +P NL+ L V + D+G+AFDGDGDR+ Sbjct: 191 QLFRDIGCEVYPLFCDVDGNFPNHSPDPTQPANLQALQTLVLEQALDIGIAFDGDGDRLI 250 Query: 250 VVTNTGTIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHS 309 V G I++PDR+L L A+ V+ PG + +DVKCT RL I GG P M +GHS Sbjct: 251 AVDGDGHILWPDRILTLLAQSVLPEQPGRVVAYDVKCTYRLDKAIHDAGGIPGMCISGHS 310 Query: 310 LIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPS 369 L+KK ++E A+L GE SGH+ ++R +DDG+Y AARLLEIL+Q+ VF+ P Sbjct: 311 LLKKYIREHDAVLGGEFSGHIVLRDRGMEYDDGVYIAARLLEILAQETASPADVFARIPE 370 Query: 370 DISTPEINIT-VTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPV 428 STPE + + ++ A + +D Q + TLDG+R +Y GWGL RASNT+P Sbjct: 371 GFSTPEHKLRFASYEAATAAMAIWMQDQQLQAQRLITLDGMRAEYADGWGLARASNTSPS 430 Query: 429 LVLRFEADTEEELERIKTVFR---NQLKAVDSSLP 460 + LRFEADT LE I+ +FR +L+ +LP Sbjct: 431 ITLRFEADTPGRLEDIRALFRADIQRLQLTPEALP 465 Lambda K H 0.319 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 466 Length adjustment: 33 Effective length of query: 430 Effective length of database: 433 Effective search space: 186190 Effective search space used: 186190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory