Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_028487962.1 Q394_RS0102925 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000621325.1:WP_028487962.1 Length = 256 Score = 135 bits (339), Expect = 1e-36 Identities = 82/250 (32%), Positives = 136/250 (54%), Gaps = 17/250 (6%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 +L+V +S H+G I+A+ DVSF V +GE+ +IG NGAGKTT+ L+GL +P +G I+ Sbjct: 4 LLQVTTVSKHFGGIKALTDVSFTVRKGEIFGVIGPNGAGKTTLFNALTGLYQPDTGAIDL 63 Query: 63 LGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLK-------------KNR 109 G + + +I+ G ++ + +F +T EN+ +G + NR Sbjct: 64 AGVSLYRRKPHEILKAGFARTFQNIRLFHNMTAQENVMVGRHTRTTSGVLAALLHTQHNR 123 Query: 110 EENQ---ANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMG 166 E + A +++ R + + + A LS G+Q+ L + RAL S PKLL LDEP+ G Sbjct: 124 REERDCAAFAQQLLDRV-GIGQHTHTLAKNLSYGDQRRLEIARALASEPKLLALDEPAAG 182 Query: 167 LAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASS 226 + P + D++ ++++G T++LIE + + I DR VL+ G+ + GT + Sbjct: 183 MNPNEKNALRDLMVSLREEGLTLMLIEHDVKLVMGICDRLVVLDYGEKIAEGTPDIVRHD 242 Query: 227 EEVRKAYLGG 236 +V AYLGG Sbjct: 243 PKVIAAYLGG 252 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 256 Length adjustment: 24 Effective length of query: 212 Effective length of database: 232 Effective search space: 49184 Effective search space used: 49184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory